(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE489

CP002209.PE489       Location/Qualifiers
FT   CDS_pept        538722..539549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0489"
FT                   /product="GumN family protein"
FT                   /note="COGs: COG3735 conserved hypothetical protein;
FT                   InterPro IPR010891; KEGG: sdn:Sden_0672 GumN; PFAM: GumN
FT                   family protein; SPTR: A2UUT5 GumN; PFAM: GumN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74703"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPN9"
FT                   /protein_id="ADN74703.1"
FT                   /translation="MRALLLLLLLPFIVWAAPDDRPPFYQVEANGRTAWLLGTIHVGSR
FT                   DFYPLPAPVESAFEQAQVLALEADPNDPEVPALLARYGRSDTPLPEPLAKQVAQRCQQL
FT                   GFACDLGVSPWLLSAQLAMLQMAQAGYQPDLGVDSMLLSRKGQKPLWQLESMGRQMAIF
FT                   TELSQSAQWAMLESTLEDADPTELVQAWRGGNAAELDALMRDGLSDSDELWQRLMVDRN
FT                   HDMASTIGDWLERQDRVFIAVGAGHLVGPDGIPTLLKQAGVTVRDCWQEACQP"
     atgcgcgcgt tactgctgtt actgttgctg ccctttatcg tatgggcggc accggatgat        60
     cggcccccgt tttaccaggt ggaggccaac ggtcgcaccg cctggctgct gggcaccatt       120
     cacgtcggtt cgcgggattt ctacccgctg cccgccccgg tggaatcggc ctttgaacag       180
     gctcaggtgc tggcactgga agcagacccc aatgaccctg aggtgcccgc tctgctggcc       240
     cgctacggcc gcagcgacac accgctgccg gagccgttgg ccaagcaggt ggcgcagcgt       300
     tgtcagcaac tgggttttgc ctgtgatctt ggcgtcagcc cctggctgct gagcgcccag       360
     ctggcgatgc tgcagatggc ccaggccggt tatcagccgg acctcggtgt cgacagcatg       420
     ctgttgtcgc gcaaggggca gaagccgttg tggcagctgg agagcatggg gcggcagatg       480
     gcgatcttca ccgagctgag ccagtcggcg cagtgggcga tgctggagtc gacgcttgaa       540
     gatgccgacc ctaccgagct ggtgcaggcc tggcggggcg gcaatgcggc cgaactggat       600
     gcgctgatgc gcgatggcct gtctgactcc gatgagctgt ggcagcgcct gatggtggac       660
     cgcaaccacg atatggcgag caccatcggt gattggctgg agcgtcagga ccgggtgttt       720
     atcgccgtcg gggccgggca cctggtgggg ccggatggga tcccgacgct gctgaagcag       780
     gccggggtca ccgtgcggga ttgctggcag gaggcctgcc agccctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page