(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE49

CP002209.PE49        Location/Qualifiers
FT   CDS_pept        complement(61376..63967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0992 hypothetical protein; SPTR: A3U4C3
FT                   Transcriptional regulator, AraC family with Parallel
FT                   beta-helix repeat (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74263"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA9"
FT                   /protein_id="ADN74263.1"
FT                   /translation="MKRTPSVPFKHPRTVLLVAMTAAGIALPSLAVVPEADNPIFNTPA
FT                   NSADSCMADAYIETGGKGLKDKVGQVINCTAEDVEIAEVTVKAVDGETSSTGDFTCTLG
FT                   DTIEVTADLRVRTNAAERYDTTFFVSRDLDSPQVVQQDEEACSILIPKNDFKGTGNAQN
FT                   LDADQCGDIAKSGLVNDEYTLVNAVFTMTCTASPGSERVEFNYCAAWDVQEDPANCSAT
FT                   GAAPGQEPSSKSKCNCDIIPLNIFIQPDPAKITKTLKSASNSGTEPMATFEYEVKIERG
FT                   STDADLVITDIDDLYRSVADSGSPKVGSSDAPILFDLDGTNSDTTIGNLTLLGADNKCY
FT                   DTVPVTLTAASPTFTCTFKVKVSDEDLPDALDPTEATPMPPAGEEEYQNFIRITSVDLN
FT                   GDNIGDNTCDVTDNLTSNDEGNCSNVIAVKITNVDPSIVITKTPVAGPGLQNIGGAWFV
FT                   EDQGLITYEITITNNSTVDALSLLALTDTSVTNLLNDSSGTPACNTYPASLSANGGKFT
FT                   CRYIVNVTLVDGASYPNTVNVDAKDNENRRTDDMAMVTITRATPSVVLVKKVAKSGDVG
FT                   IPTPAIDSASFMDSVTIDEPGGSAHPVVYRFTVTNNNTTTKEDLTLNSLEDNVLFGSVR
FT                   ATAAPVQRSDECAFPQTLVFGTPYVCTLVAYVDGNATNVSDTAYDDTQLVNTAFVKATS
FT                   TQGKQIQSQPDSATVLFKDVPPTVTGKYGLAGTIFIAVKNTSFEAIWLSELSIFNTPVK
FT                   DGNLFNGYRIVNDGGTLTGIDEDPTTPVSDAPLACEEPGYTLKLDPGEEYVCAFTVELA
FT                   DFNEGDFAEFQADILRGAPNRNVVVKFVDEEGTPVTTDAEVQVKTGDNIDQ"
     atgaaacgca caccatcggt tccattcaaa cacccaagaa cggtgttgtt ggttgccatg        60
     acggctgcgg gcattgccct tcccagcctc gccgtcgttc ctgaagccga caatccgatt       120
     ttcaatacac cggccaactc tgccgattcc tgtatggcgg acgcctacat cgagaccggc       180
     ggcaagggcc tgaaagacaa agtcggtcag gtcattaact gtaccgccga agatgttgag       240
     atcgcagaag tcaccgtcaa agcggtggat ggcgaaacct catcaaccgg cgacttcacc       300
     tgtaccctcg gtgacaccat tgaggtcacc gccgacctgc gtgttcgcac caatgcggcc       360
     gaacgctatg acaccacctt cttcgtttcc cgggatctcg actcccccca ggtggttcaa       420
     caggacgagg aggcgtgcag cattctgatc ccgaaaaatg acttcaaggg aacgggcaac       480
     gcccagaacc tggatgccga ccaatgcggc gacatcgcca agtccggcct ggtgaatgac       540
     gagtacacct tagtgaacgc cgtgttcacc atgacctgta ccgcctctcc cggcagcgag       600
     agggtggagt ttaactactg cgccgcctgg gatgttcagg aggacccggc aaactgctcc       660
     gccaccggcg cggccccggg ccaggagccc agctccaagt cgaaatgtaa ttgcgacatc       720
     atcccgctga acatcttcat tcagccggac ccggccaaaa tcaccaaaac cctcaagagt       780
     gccagcaaca gcggtaccga gccgatggcc acattcgagt acgaagtgaa gattgagcgt       840
     ggcagcaccg acgcggatct ggtgatcacc gacatcgatg atctctaccg ctccgttgcc       900
     gacagcggca gccccaaggt gggcagcagc gatgcgccca tcctgtttga tctggatggc       960
     accaacagcg acaccaccat cggcaacctg actctgcttg gtgccgacaa taagtgctat      1020
     gacaccgtgc cggtcaccct gaccgccgcc agtccgactt tcacctgtac ctttaaggtc      1080
     aaagtcagcg acgaagacct gccggatgcc ctcgacccca ccgaagccac cccgatgccg      1140
     ccagctggcg aagaggagta tcagaacttt atccgcatca cttcggtcga cctcaatggc      1200
     gacaacattg gtgacaacac ctgtgacgtc actgacaacc tcaccagcaa cgatgagggc      1260
     aactgctcca acgtcatcgc cgttaagatc accaatgttg atccgagcat cgtcatcacc      1320
     aaaaccccgg tggcaggccc cggcctgcaa aacatcggtg gggcctggtt tgttgaggat      1380
     cagggtctga tcacctatga gatcaccatc accaacaaca gcaccgtcga cgccctgagc      1440
     cttctggccc tgaccgatac gtcggtcacc aacctgttga atgacagctc aggaacgccg      1500
     gcctgtaata cctatcccgc ttcgctcagt gccaatggag ggaaatttac ctgccgctac      1560
     atcgtcaatg tcactctcgt tgatggtgca agttacccga acacggtcaa cgttgacgcc      1620
     aaggacaatg agaatcgccg taccgacgat atggcaatgg tgaccatcac ccgagccacc      1680
     ccgagcgtgg ttctggtgaa gaaagtggcc aagtccggtg atgtgggcat ccccaccccg      1740
     gcaatcgatt ccgccagctt tatggattcg gtcaccatcg acgagcccgg tggcagtgcc      1800
     catccggtgg tctatcgctt taccgtcacc aacaacaaca caaccaccaa ggaagacctc      1860
     accctcaaca gcctggagga caacgtcctg tttggcagcg ttcgcgccac cgcagctccg      1920
     gtgcagcgca gcgatgagtg tgctttcccg cagactctcg tcttcggtac cccttacgtc      1980
     tgtaccctgg tggcctatgt ggacgggaac gcgacgaatg tcagcgatac cgcctacgat      2040
     gacactcaac tggtcaacac cgcgtttgtg aaagcgacca gtacgcaagg caagcagatt      2100
     cagtcccagc cggacagcgc caccgtgctg tttaaagatg tgccgcccac cgttaccggc      2160
     aaatatggcc tggcgggcac catctttatc gctgtgaaga acaccagctt cgaagcgatc      2220
     tggctcagcg aactgagcat cttcaataca ccggtgaagg acggcaacct gttcaatggt      2280
     taccgtatcg tcaacgatgg cggcaccctg accggcattg atgaagaccc gaccactccg      2340
     gtctctgatg cgcctcttgc ctgtgaggaa ccgggttaca ccctcaagct ggatccgggt      2400
     gaagagtacg tctgtgcctt taccgtggaa ctggcagact tcaacgaagg ggactttgcg      2460
     gaattccagg ccgacattct gcgcggcgca ccgaaccgca atgttgtcgt gaagtttgtc      2520
     gatgaggagg gaaccccagt caccaccgac gccgaagtgc aggtgaagac cggcgataac      2580
     atcgaccaat aa                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page