(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE492

CP002209.PE492       Location/Qualifiers
FT   CDS_pept        541222..541794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0492"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="COGs: COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A); InterPro
FT                   IPR015365: IPR001059: IPR013185: IPR013852: IPR 011768;
FT                   KEGG: dda:Dd703_0466 translation elongation factor P; PFAM:
FT                   Elongation factor KOW domain protein; Elongation factor P ;
FT                   Elongation factor P/YeiP protein; SPTR: A3WLU2 Elongation
FT                   factor P; TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P, C-terminal; Elongation factor P (EF-P)
FT                   KOW-like domain; Elongation factor P (EF-P) OB domain;
FT                   TIGRFAM: translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74706"
FT                   /db_xref="GOA:E1SPP2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP2"
FT                   /protein_id="ADN74706.1"
FT                   /translation="MASYATNEFRSGLKIMLDGEPCNIIENEFVKPGKGQAFNRVKIRK
FT                   LLTGKVLEKTFKSGDTVEAADVMDHELAYLYNDGEFWHFMNNDTFEQIAADAKAVGDAE
FT                   KWLVEQDVCTITVWDGNPITVTPPNFVELEVTETDPGLKGDTQGTGGKPATLVTGAVVR
FT                   VPLFIAIGEVVKVDTRTGEYVERVRSK"
     atggcttctt acgcaacaaa cgaatttcgt tccgggctaa agataatgct ggacggtgag        60
     ccgtgcaaca tcatcgagaa cgagttcgtt aagccgggca aaggccaagc ctttaaccgt       120
     gtgaaaatcc gcaaactgct gaccggcaag gtactggaaa aaacctttaa atccggcgac       180
     accgttgaag cggctgacgt gatggaccac gaactggctt acctctacaa cgacggtgag       240
     ttctggcact ttatgaacaa cgacaccttc gagcagatcg ccgctgacgc gaaagccgtg       300
     ggcgacgctg agaagtggct ggtggagcag gacgtatgca ccatcaccgt gtgggacggt       360
     aacccgatca ccgtgacccc gccgaacttc gttgagctgg aagtgaccga aactgacccg       420
     ggcctgaaag gcgacaccca gggcaccggc ggcaagcccg ctaccctggt aaccggcgct       480
     gtggttcgcg taccgctgtt tatcgccatc ggcgaagtgg tgaaagtgga cacccgtacc       540
     ggcgaatacg tcgagcgcgt acgcagcaag taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page