(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE493

CP002209.PE493       Location/Qualifiers
FT   CDS_pept        541908..542879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0493"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="COGs: COG2269 Truncated possibly inactive lysyl-tRNA
FT                   synthetase (class II); InterPro IPR018149: IPR004364:
FT                   IPR006195: IPR004525; KEGG: vpa:VP2838 lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   SPTR: Q87KY6 Putative lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase-related protein GenX; PFAM: tRNA
FT                   synthetases class II (D, K and N); TIGRFAM: lysyl-tRNA
FT                   synthetase-related protein GenX"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74707"
FT                   /db_xref="GOA:E1SPP3"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP3"
FT                   /protein_id="ADN74707.1"
FT                   /translation="MSQSWQPTATMAVLKQRAQLMGRIRDFFAERGVWEVETPCLSQAA
FT                   VTDVHLHNFDTRFVGPGAAEGIPLYLMTSPEYHMKRLLCAGSGSIFQLCRSFRNEEAGR
FT                   FHNPEFTMLEWYRVGFDHHALMDEMADLLQAVLGCGAPQRMTYAQAFEQALGVNPLEAS
FT                   LAQLKALCEQHGMGDLAEAEQDADTLLQLLFATQVESRIGQTVPAMVYHFPASQAALAR
FT                   IDEQDPRVARRFEVYFKGVELANGFHELADADEQRARFVADNAQRAAHGLPQRPIDEHL
FT                   IAALAAGLPDCAGVALGIDRLVMLALDAKAIKDVIPFPVFNA"
     atgagccagt cctggcaacc taccgctacc atggcggtgc tgaaacagcg ggcccagttg        60
     atgggccgga tccgtgactt ctttgccgag cgtggcgtgt gggaagtgga aaccccttgc       120
     ctgtcccagg cagcggtcac cgacgtgcat ctgcacaact ttgatacccg ctttgttggc       180
     cccggtgccg ccgaaggcat cccgctctac ctgatgacct cgccggaata ccacatgaag       240
     cgcctgctgt gcgcgggcag tggctccatc ttccagctgt gccgcagctt ccgtaatgaa       300
     gaggccgggc gttttcacaa tcccgagttc accatgctgg agtggtatcg ggttgggttt       360
     gatcaccatg ccctgatgga tgagatggcg gacctgctgc aagcggtgct gggctgcggt       420
     gcgccgcagc ggatgaccta cgcccaggcc tttgagcagg ctctgggggt gaaccctctg       480
     gaagcgtcgc tggcgcagct gaaagccctg tgtgaacagc acggcatggg cgacctggcc       540
     gaagcggaac aggatgccga taccctgctg caactgctgt ttgccacaca agtggagtcc       600
     cgcatcggcc aaacggtgcc ggcgatggtg tatcacttcc cggcttcaca ggcggcactg       660
     gcccgcatcg atgaacagga cccccgtgtt gcacggcgct ttgaggtcta tttcaaaggg       720
     gtggagctgg caaacggctt ccacgaactg gcggacgcgg atgaacagcg ggcccgtttt       780
     gttgcggaca atgcgcagcg tgcggcccac ggcttaccgc aacgtccgat cgatgagcac       840
     ctgattgccg cgctggcagc gggactgccg gattgtgccg gagtggcgct ggggatcgat       900
     cgactggtga tgctggcgct ggacgccaaa gcgataaaag atgtgatccc cttcccagtt       960
     tttaacgcct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page