(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE494

CP002209.PE494       Location/Qualifiers
FT   CDS_pept        542934..543227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0494"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Protein of unknown function (DUF2607)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74708"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP4"
FT                   /protein_id="ADN74708.1"
FT                   /translation="MVRIPRASAMIMAFWLLAIALVAPAHELSHVHDDITFSEHCDFFA
FT                   HQAQLQQLFSHQLAPLDPVTPFRWQADTLPLSPWLSLQVAYTARAPPLNSRV"
     gtggttcgga taccccgtgc atcagcgatg ataatggcgt tctggctgct ggcgattgcg        60
     ctggtggccc ctgcccatga gctgagtcac gtccacgacg acatcacctt ttccgaacac       120
     tgcgacttct ttgcccacca ggcccagctg cagcagcttt tcagccacca gctggcgccg       180
     cttgacccgg ttaccccatt ccgttggcag gcggacactc tgcccctttc cccctggctg       240
     tcgctacagg ttgcctacac cgcccgcgca ccaccactta attctcgagt ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page