(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE495

CP002209.PE495       Location/Qualifiers
FT   CDS_pept        543287..544474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3716 hypothetical protein; SPTR:
FT                   A2UUT0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74709"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E1SPP5"
FT                   /protein_id="ADN74709.1"
FT                   /translation="MKNRISLAVGVALAGAPFLSLAAPEGTLTNPNLSLVLDGYYQDGE
FT                   RALGEREEGFNLGHTELAISAAIDDKFYGKLTTVLETHDGETEIGLEEAFIQTLAMPGG
FT                   LSVRAGRFLSDIGYLNNQHLHTDAFVERPAAYRAFLGGHYFDDGVRINWVAPTDFYWEF
FT                   GGEAFSGDPLQAEELESVETVGVYHLYTKLGGDIGQSHSWQASLSWLRNENGQSHAGEH
FT                   DHDLEVAELADDHDHEHGHGAAFTGRDLFNVSAVYKWAPGGNYKYNHFTLSGEYFYLDA
FT                   PFEHEEGHDEEEAGPDYYDGWYLSGVYQFSPSWSAGVRYGEMSAAMLEIHDDHGHFHDA
FT                   RIKETEAMVAWHPSHFSAVRLQYTHQDLTEFGDFDDQVITLQYVMTLGAHGAHQF"
     atgaaaaacc ggatttccct tgctgtcggc gtggcgctgg ctggcgcgcc ttttctgtct        60
     ctggctgccc cggaaggcac cctgaccaat cccaacctgt ccctggtact ggacggctac       120
     tatcaggatg gtgagcgcgc cttgggcgaa cgcgaggagg gttttaacct gggccacacc       180
     gagctggcca tctccgccgc catcgacgac aagttctacg gcaaactgac caccgtgctg       240
     gaaacccacg acggtgaaac cgagattggc ctggaagagg cctttatcca gactctggcc       300
     atgcccggtg gcctatcggt tcgcgccggt cgcttcctgt ccgacatcgg ttacctgaac       360
     aaccagcacc tgcacaccga cgcctttgtt gagcgcccgg cggcctaccg tgctttcctc       420
     ggtggtcact actttgatga tggtgtgcgc atcaactggg tagccccgac cgacttctac       480
     tgggagtttg gcggtgaggc cttcagtggt gatccgctgc aggcggagga gctggagagc       540
     gtcgaaaccg ttggcgttta ccacctctac accaaactgg gtggcgacat tggccagtcc       600
     cacagctggc aggccagcct gtcctggctg cgcaatgaga atggccagtc gcacgccggt       660
     gagcatgacc atgatcttga agtggcagag ctggccgacg atcacgacca cgagcatggc       720
     cacggcgccg cgtttaccgg ccgcgacctg ttcaatgtct ccgctgtgta caagtgggcg       780
     ccgggcggca actacaagta caaccacttc accctgagcg gcgaatactt ctacctcgat       840
     gcgccctttg aacatgaaga gggccacgac gaagaggaag ccggtccgga ctattacgac       900
     ggctggtacc tgtccggcgt ttatcagttc agcccgagct ggtccgccgg tgtgcggtat       960
     ggcgagatga gtgcggccat gctcgagatc cacgatgatc acggccactt ccatgatgcc      1020
     cgcatcaagg aaaccgaagc gatggtggcc tggcacccga gccacttctc tgcggttcgc      1080
     ctgcagtaca cccatcagga tctgaccgag ttcggtgatt tcgacgatca ggtgattacc      1140
     ctccagtacg tgatgacact gggagcgcat ggtgcacatc aattctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page