(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE54

CP002209.PE54        Location/Qualifiers
FT   CDS_pept        70404..71708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0054"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="COGs: COG4102 conserved hypothetical protein;
FT                   InterPro IPR010869: IPR019546: IPR006311; KEGG:
FT                   vvu:VV1_2853 hypothetical protein; PFAM: protein of unknown
FT                   function DUF1501; Twin-arginine translocation pathway,
FT                   signal sequence, subgroup; SPTR: A0XXJ1 Putative orphan
FT                   protein; PFAM: Protein of unknown function (DUF1501);
FT                   TIGRFAM: Tat (twin-arginine translocation) pathway signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74268"
FT                   /db_xref="GOA:E1SVB4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB4"
FT                   /protein_id="ADN74268.1"
FT                   /translation="MPISRRTFLKGIGASALMSQVGWATASTAVSDYRALVCIYFNGGN
FT                   DGFNTLVPTDDTHYQEYANIRKHLAIPQANLLTTSLSGRDRAGNTVELGLHPSMEGLKA
FT                   LCDRGYVTGLLNCGVLKRPMTVADHGAEPDMLFSHNSQTYEWLRGDAINKSLSSGWGSR
FT                   LMAQLSQQSDIPPMYSFAGQSRLFRGPDKANSLSASGAQTITMRTFLKNRYIQTLDNER
FT                   PDPFREHFRGIMRDSIYASQTVNGVISGAANATLAADSDNPLSLQLDATLKFINSRESL
FT                   TQNRQIFFLNLGGFDTHANQVSSHEALLSQFSRAVKNFYDLLDEQGLSSKVTTVTLSDF
FT                   GRRIIPNATGTDHGWGNNQFVISGAPMAGTTVGTWPSLVPGGEDDFSAGRLLPTTSVDQ
FT                   IGATLARWMGVAEPDLQAVFPNIANFTPKALPLFS"
     atgccaattt caagaagaac gtttttaaag ggaataggcg catcagcctt aatgtctcaa        60
     gtgggctggg caaccgcttc gacggcggtc agcgactacc gggcactggt ttgcatctac       120
     ttcaacgggg gcaacgatgg gttcaatact ctggtgccca cggacgatac gcactatcag       180
     gagtacgcga acatccgtaa acacctcgcg atcccgcaag ccaacctgct gaccacgtca       240
     ttgtccggac gggatcgagc cggcaatacg gttgaactgg gattgcaccc ctcgatggag       300
     ggcctcaagg cgctgtgtga ccggggctat gtaaccggac tgctcaattg cggagtgctg       360
     aaacggccca tgacggttgc ggatcatggg gcagaacccg acatgctgtt ctcccataac       420
     tcccagacct acgagtggct gcggggagac gccatcaaca aatccctgag cagtggttgg       480
     ggatcgcggc tgatggcgca gctaagccag caaagtgaca tccccccgat gtacagcttc       540
     gcgggtcagt cccggctgtt ccgggggccg gataaagcca acagtttgtc agcctccggg       600
     gcgcaaacca tcaccatgag gactttcctt aaaaatcgct acatacagac gctggataat       660
     gaaaggcctg atccctttcg ggagcatttc cgcggcatca tgcgagacag catttacgcg       720
     agccagacgg tgaatggtgt gatcagtggg gcggccaacg cgaccctggc cgcggacagc       780
     gacaacccgc ttagtctgca gctggacgca acgctgaagt tcatcaacag tcgggaatca       840
     ctgacccaga accggcagat cttctttctc aacctggggg gattcgatac ccatgccaac       900
     caggtgtcca gtcatgaggc gctgctgtct caattcagcc gggcggtgaa aaacttctat       960
     gacctgctgg atgaacaagg gctgtcgtcc aaggtgacga cggtaaccct gtctgatttt      1020
     ggccgtcgca tcatccccaa tgccaccggg actgaccacg gttggggcaa caaccagttt      1080
     gtgatcagcg gcgccccaat ggccgggaca acggtcggca cctggccttc gttggtgccc      1140
     ggaggggagg acgacttctc tgccggccgt ctgcttccca ccacctcggt ggatcagatt      1200
     ggtgccacac tggcgcgttg gatgggagtg gccgagccgg acttgcaagc cgtattcccc      1260
     aatatcgcca attttacccc caaggcgttg ccactgttca gctga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page