(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE56

CP002209.PE56        Location/Qualifiers
FT   CDS_pept        73586..74278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0144 hypothetical protein; SPTR:
FT                   A2UXY0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74270"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVB6"
FT                   /protein_id="ADN74270.1"
FT                   /translation="MMKRSLIALALCLPAIGAGAAEYEVDFGYDSKYISQGRDNLEQGG
FT                   IYWASGAAGFDNGIVLSAAYGYAADSDVDYDELNLGIEYGFELGDFAFYGSYTRLEFFK
FT                   DDEADNELGAGVAYGGLSWFEPFIDYVYSTESEGSFVEIGIQREFALNERLALTPYVIA
FT                   GLDYGYANPDHDGENHLAVGATLGYQLTEQLGLTLIAEHTEAHRQMAKDEGIETDQTWA
FT                   GIHLTMAF"
     atgatgaagc gatccctgat agccctggcc ctctgtcttc ccgccattgg tgcgggcgcg        60
     gccgaatatg aagtcgattt tgggtacgac agcaagtaca tctctcaagg ccgggataac       120
     ctggagcagg gaggcatcta ttgggccagc ggtgccgcgg gctttgataa tggcatcgtg       180
     ctcagtgccg cttacggcta tgccgccgac tccgatgtgg attatgacga actgaatctg       240
     ggcatcgagt acggttttga gctgggtgat ttcgccttct acggcagcta tacccgcctt       300
     gagttcttta aagatgacga agccgataat gagcttgggg cgggggtcgc ctacggtggc       360
     ctgagctggt ttgagccctt tatcgactac gtctacagca ccgaatctga gggcagtttt       420
     gttgaaatcg gcattcagcg ggagtttgcc ctgaatgagc gcctggccct gacgccctat       480
     gtgatcgccg gtttggatta tggctacgcc aatccggatc atgatggcga aaaccacctg       540
     gccgtggggg ccaccctggg ataccagtta accgaacagc tggggctgac cctgatcgcc       600
     gaacacactg aggcccaccg ccagatggct aaggatgagg ggattgaaac ggatcaaacc       660
     tgggcgggta tccacctgac catggcgttt taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page