(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE60

CP002209.PE60        Location/Qualifiers
FT   CDS_pept        79131..79847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0060"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: tgr:Tgr7_1609
FT                   transcriptional regulator, TetR family; PFAM: regulatory
FT                   protein TetR; PFAM: Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74274"
FT                   /db_xref="GOA:E1SVC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC0"
FT                   /protein_id="ADN74274.1"
FT                   /translation="MNKSELFKAREQRILSAALVTARGKGALDFRMADVARAAECSVGT
FT                   LYGHFLSKEDMMAALVQISLQQRHEWIARLNEMELTPMERFVTLLASERVRLLRDDVLA
FT                   QLELLVSHTELWRRAADQRQLALRALVEELVKALEGILQDARQQNLLAVGEAECSTLVA
FT                   RARALLLGFQLQSSRQTLAPTAELAETDGLLDALANLLAGAGLAEGHTEWRTRCREALR
FT                   QYPALPEVAIQAPNAA"
     atgaacaagt cggaactgtt caaagcgcgg gaacagcgca tcttatcggc ggcattggtc        60
     actgcccggg gcaagggagc cctggacttt cgtatggcgg acgtcgcacg cgcggcagaa       120
     tgctccgtgg gcacactgta cggccacttc ctcagcaaag aagacatgat ggcagcgctg       180
     gttcagatca gcctgcaaca gcgtcacgag tggatcgccc gtctcaacga gatggaactg       240
     accccgatgg aacgctttgt taccctgctg gcctctgagc gcgtacgcct gctgcgcgat       300
     gacgtgctgg cccagctgga actgctggta agccacaccg agctgtggcg tcgtgccgct       360
     gaccagcgtc agctggcgct gcgtgcgctg gtggaagagc tggtgaaagc gctggagggg       420
     atcctgcagg acgcccgtca gcagaacctg ctggcggttg gcgaagccga gtgcagcact       480
     ctggtcgctc gtgcccgtgc cctgttgctg ggcttccagt tgcaatccag ccgtcaaacc       540
     ctggccccga ctgcggagct ggcggaaacc gacggtctgt tggatgcgct ggccaatctg       600
     ctggccggtg ccggcctggc cgaaggccat accgagtggc gtacccgctg ccgtgaggca       660
     ctgcgtcaat acccggctct gccggaagtg gccatccagg cgccgaacgc cgcctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page