(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE65

CP002209.PE65        Location/Qualifiers
FT   CDS_pept        83422..84198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0065"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: she:Shewmr4_0298 TetR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: A2UXH6 Transcriptional regulator, TetR family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74279"
FT                   /db_xref="GOA:E1SVC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVC5"
FT                   /protein_id="ADN74279.1"
FT                   /translation="MQCPSTEAQFERSQLILNATEWLIETQGLIAFKISDLSNHAGIAN
FT                   SSLYKLFESKEDLLVCCFLRNATSNHFAPFEAQYPDLTPIQRVLIPIMFTFEATHFAPT
FT                   FNLVRQVAVNPMVWRRASPEKVKAFETRINLFWRAIKGYVVEAVESGDLVATEEEVLEL
FT                   TQAITFYLSGALSAYQSQLINNTYLKEKRYTLFRQLQKVFLPYQWRQQMELADFERIGM
FT                   RVHLYYRQLGETFNRCERCQQAGQCGAGTSPSVATE"
     atgcaatgcc ccagcacgga agcgcagttt gagcgcagcc aattgatctt aaacgcgact        60
     gagtggttga ttgagactca gggcctgatc gcgttcaaaa tttctgatct gtccaaccat       120
     gccggcatcg ccaacagctc cctctataag ctgttcgaaa gcaaggaaga cctgttggtg       180
     tgctgcttcc tgcgcaacgc caccagcaac cactttgccc cgtttgaagc ccagtatccg       240
     gacctgactc cgatccagcg ggtgctgatc cccatcatgt tcacctttga agccacccac       300
     tttgccccga ccttcaacct ggtgcggcag gtggcggtga acccgatggt gtggcgccgg       360
     gccagcccgg agaaggtgaa agccttcgag acccgcatca acctgttctg gcgcgcgatt       420
     aagggatacg tggtcgaagc ggtggaatcc ggcgacctgg tggccacgga ggaggaggta       480
     ctggaactga ctcaggcgat caccttctac ctgagtgggg cgctgtcggc gtatcagagc       540
     cagctgatca acaacaccta tctgaaagag aagcgctaca ccctgttccg gcagctgcag       600
     aaggtgtttc tgccctatca gtggcggcag cagatggaac tggccgattt tgagcgcatc       660
     gggatgcggg tgcatctcta ctaccgccag ctgggcgaaa ccttcaaccg ttgtgaacgt       720
     tgccagcaag ccggacagtg cggggcgggg acgtcgccat ccgtggcgac cgaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page