(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE70

CP002209.PE70        Location/Qualifiers
FT   CDS_pept        88659..89180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0070"
FT                   /product="ribosomal protein N-acetylase-like protein"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   sse:Ssed_2792 ribosomal protein N-acetylase-like protein;
FT                   SPTR: A2TTT1 Acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74284"
FT                   /db_xref="GOA:E1SVD0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD0"
FT                   /protein_id="ADN74284.1"
FT                   /translation="MTPLIRGPRLSLYRFAPRDAAGFMAMNADPRVVQHTGDRPFADEA
FT                   DALRFIQHYDHYQRHGFGRWSLYTHEGEYAGFCGLRRAAGEVDLGYRLPWRLWGRGLAT
FT                   EAAQLALQLGFERFDLGSIVGRARCANPGSIRVLEKVGMGLEGAFTEEGHDWLQYRIRS
FT                   HEWTGLPFLR"
     gtgactccgc tcatccgcgg gccccggctg tcactgtatc gctttgcgcc gcgagatgcg        60
     gcgggcttta tggcgatgaa tgccgacccg cgggtggtac agcataccgg tgaccggccc       120
     tttgccgatg aagccgacgc cctgcgtttt atccaacact acgatcacta tcagcgccac       180
     gggtttggcc gctggtcgct ctatacccac gagggggagt acgccggatt ctgtggcttg       240
     cgacgggccg ccggtgaggt ggatctgggc taccgcctgc cctggcgtct gtgggggcgg       300
     ggactggcga ccgaagccgc gcaattggcg ctgcaactgg gattcgagcg gtttgacctc       360
     ggcagcattg ttggccgcgc ccgctgtgcc aacccgggct ccatccgggt gctggagaag       420
     gtcgggatgg gtctggaggg ggcttttacc gaagagggcc acgactggct gcagtaccgt       480
     attcgaagcc atgagtggac cgggttgccc tttttgcgtt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page