(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE71

CP002209.PE71        Location/Qualifiers
FT   CDS_pept        89314..90636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0071"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: slo:Shew_3581 peptidase M16
FT                   domain-containing protein; PFAM: peptidase M16 domain
FT                   protein; SPTR: A2V2M7 Peptidase M16-like; PFAM: Peptidase
FT                   M16 inactive domain; Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74285"
FT                   /db_xref="GOA:E1SVD1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD1"
FT                   /protein_id="ADN74285.1"
FT                   /translation="MGIRLATLALGLALSPLSQANTADEVQTLDLANGMRILVLEDDTI
FT                   PNANMYLFWKVGSRNEVPGITGLSHFFEHMMFNGSEQFGPKMFDRTMEAAGGANNAYTT
FT                   ENLTVYTDWFPADAMETIFKLEADRIANLSIDPAMVESERGVVDSERRTGLENSNWRML
FT                   QEEVKGVAFRAHPYSAPVIGHQSDIHAWTQDDLVNFHRTYYAPNNAVVVISGAVTFEQV
FT                   NALAQQYFAPIPAQTPPPAVRTVEPEQKGERRVYVQKPSVSTPNLMLAYKIPATDSADY
FT                   HALDLAMSLLIDGNSSRLSRALVDKQLALGVDGYMPESFDPNLFYLYAVAAAGVDAAQL
FT                   EAAMIAEVNRLAAEPVTQAELDKVKNRKLMAFYDTMETINGKSNTLGTYELFFGDYRAL
FT                   FNAPQAYEAVTAEQIQQVAQKYLIKARRTVGVLAAEEDTDQ"
     atggggatcc gcctggcgac cctggcgctg gggctggcac tgagcccgct ctcccaggcc        60
     aacactgccg acgaggttca gactctggat ctggccaacg gcatgcgcat cctggtgctc       120
     gaggatgaca ccatcccgaa cgccaatatg tacctgttct ggaaagtggg ctcgcgcaac       180
     gaagtgcccg gcattaccgg cctgtcccac ttctttgagc acatgatgtt caacggctcc       240
     gaacagttcg gcccgaagat gtttgaccgc accatggaag cggcgggcgg cgccaacaac       300
     gcctacacca cggagaacct gacggtctac accgattggt tcccggccga tgccatggaa       360
     accatcttta agctggaagc ggatcgcatc gccaacctgt ccatcgaccc cgccatggtg       420
     gagagcgagc gtggcgtggt ggactccgag cgtcgcaccg gcctggaaaa ttccaactgg       480
     cgaatgctgc aggaagaggt gaagggcgtg gcgttccggg ctcatcccta cagcgccccg       540
     gtgatcggtc atcagtccga catccacgcc tggacccagg atgacctggt caacttccac       600
     cgcacctact acgcccccaa caacgccgtg gtggtgatct ccggcgccgt gacctttgaa       660
     caggtcaatg cgttggctca acagtacttc gccccgatcc cggcccagac cccgccaccg       720
     gcggtgcgca ccgtggagcc ggagcagaaa ggcgaacgcc gggtgtacgt gcagaagccc       780
     tcggtctcga cccccaacct gatgctggcc tacaagattc cggccaccga cagcgccgat       840
     taccacgcgc tggatctggc catgtccctg ctgatcgacg gcaacagcag ccgcctcagt       900
     cgcgcgctgg tggataagca actggcgctg ggcgttgacg gttatatgcc ggaaagcttc       960
     gaccccaacc tgttctacct ctacgccgta gcggcggcag gtgtggatgc ggcgcagctt      1020
     gaggcggcga tgattgccga agtgaaccgt ctggccgccg agccggtcac tcaggctgag      1080
     ctggataagg tgaagaaccg caagctgatg gcgttctacg acaccatgga aaccatcaac      1140
     ggcaagtcca ataccctggg cacctacgag ctgttctttg gcgattaccg cgccctgttc      1200
     aacgcgccgc aagcctatga ggcggtcact gctgagcaga ttcagcaggt ggcgcagaaa      1260
     tacctgatta aagcccgccg caccgtcggg gtgctggccg cggaggagga caccgaccaa      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page