(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE72

CP002209.PE72        Location/Qualifiers
FT   CDS_pept        90633..92081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0072"
FT                   /product="peptidase M16 domain protein"
FT                   /note="COGs: COG0612 Zn-dependent peptidase; InterPro
FT                   IPR011765: IPR007863; KEGG: shw:Sputw3181_0448 peptidase
FT                   M16 domain-containing protein; PFAM: peptidase M16 domain
FT                   protein; SPTR: A2V2M6 Peptidase M16-like; PFAM: Peptidase
FT                   M16 inactive domain; Insulinase (Peptidase family M16)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74286"
FT                   /db_xref="GOA:E1SVD2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD2"
FT                   /protein_id="ADN74286.1"
FT                   /translation="MKAKMMLMSALVMAGCSATQQPAQPAKTTNPTPAPVAVAPTPKFA
FT                   LPEYQVRTLDNGLTVYLMERHQVPLITVNAVVRAGAVNDSEPGLAALTAESLLLGTSKM
FT                   KKAELEALVDGLGASLTAGAGKEGTTVNARFLAKDTDTMLDLVADVLQHPSFPSDEVKK
FT                   ARDRYVAMLAQQKESPRTVIRQYFDMLYYGDHPYANTTVGDGARLSQLDAFDLRMFHGS
FT                   WFQPRNAAIVVAGDFDADAMARAIEQRFGTWRDGDTPTAPKLNQPVKVPQQARVLLVDK
FT                   PDARETTFLIGGPGVARDNPDYVGLQVINTILGGRFTSWLNDELRVNAGLTYGARSGFT
FT                   SYGEAGSFQISTFTATETTQEAIDLALKTYQRLWQQGIDEATLASAKAYVKGQFPPRYE
FT                   TSGQLAGLLGQMYLYDLSDAQVNAFQQQVDALTLEQAQALVAKYFPKADLQFVLVGQAD
FT                   AIRGVAAQYGEVAEVAISDHGFWF"
     atgaaagcca agatgatgct gatgagcgcg ctggtgatgg ccgggtgctc cgcgacccaa        60
     caaccggctc agcccgcgaa aaccactaac ccgaccccgg cccccgtagc cgtggcgccg       120
     acgccaaagt ttgccctgcc tgagtatcag gttcgcactc tggataacgg cctgaccgtc       180
     tacctgatgg aacgccatca ggtgccgctg atcaccgtga atgcggtggt gcgtgccggc       240
     gcggtcaacg acagtgagcc gggtctggcg gcgctgacgg ctgagagcct gttgctgggg       300
     accagcaaga tgaaaaaggc ggagctggaa gcgctggtgg atggcctggg tgccagcctg       360
     actgccggtg ccggcaaaga gggcaccacc gtcaatgccc gtttcctggc caaggacacc       420
     gacaccatgc tcgacctggt ggcggatgtg ctgcaacacc ccagtttccc ctctgacgag       480
     gtgaagaagg cgcgggaccg ttacgtggcg atgctggcgc agcagaaaga gagcccccgc       540
     acggtgatcc gtcagtactt cgacatgctg tactacggcg accatcccta cgccaacacc       600
     accgtcggtg acggtgcccg cctgtcccag ctggacgcgt ttgacctgcg catgttccac       660
     ggcagctggt tccagccgcg caatgccgcc atcgtggtgg ccggcgactt cgatgccgat       720
     gccatggctc gcgccattga gcagcgcttc ggtacttggc gggatggcga caccccgacc       780
     gcgcccaagc tgaaccagcc ggttaaggta ccgcagcagg ctcgggtgtt gcttgtggac       840
     aagcccgacg cccgcgaaac caccttcctg attggcggcc cgggtgtggc ccgggacaac       900
     ccagattacg ttggtctgca ggtgatcaac accatcctcg gcggtcgctt tacctcctgg       960
     ctcaacgatg agttgcgggt taacgccggc ctgacctatg gggcccgttc cggcttcacc      1020
     agttacggtg aagcgggcag cttccagatc agcaccttta ccgccaccga aaccactcag      1080
     gaagcgatcg acctggcgct gaaaacctac cagcgtctgt ggcagcaggg cattgacgaa      1140
     gccaccctgg cgtccgccaa agcgtacgta aagggtcagt tcccgccgcg ctacgaaacc      1200
     tcggggcagc tggccgggct gctggggcag atgtacctgt atgacctcag cgatgcccag      1260
     gtgaacgcgt tccagcagca ggtggacgcc ctgaccctgg agcaggctca ggcgctggtg      1320
     gccaagtatt tccccaaagc cgatctacag tttgtgctgg tgggccaggc ggatgccatt      1380
     cgtggcgtcg cggcccagta cggtgaagtg gcggaagtgg ccatcagcga ccacggtttc      1440
     tggttctga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page