(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE76

CP002209.PE76        Location/Qualifiers
FT   CDS_pept        complement(94511..96541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0076"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="COGs: COG0480 Translation elongation factors
FT                   (GTPase); InterPro IPR000640: IPR004161: IPR000795:
FT                   IPR005517: IPR 005225; KEGG: saz:Sama_1118 elongation
FT                   factor G; PFAM: elongation factor G domain IV; protein
FT                   synthesis factor GTP-binding; elongation factor G domain
FT                   protein; elongation factor Tu domain 2 protein; SPTR:
FT                   Q9X1Y4 Elongation factor G-like protein; TIGRFAM: small
FT                   GTP-binding protein; PFAM: Elongation factor Tu domain 2;
FT                   Elongation factor G C-terminus; Elongation factor Tu GTP
FT                   binding domain; Elongation factor G, domain IV; TIGRFAM:
FT                   translation elongation factor EF-G; small GTP-binding
FT                   protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74290"
FT                   /db_xref="GOA:E1SVD6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD6"
FT                   /protein_id="ADN74290.1"
FT                   /translation="MPEHRIEQIRNAALMGHSGSGKSSLLEALLYGARAISQRGRVDDG
FT                   TNHADFTPQEKAHHHSLEASFLSLDHNDIHINLIDTPGLPDFFGRAQLAMPAVESVLLV
FT                   INASRGIEPIAQRAFEEARRQGKSILIVVNQMDGNEAQLESVLEQIQTQFGHGCLPLNL
FT                   PKADGTGVVDCYFSPDYDTPTRFGDVRSCHDALIDTVVEQDEALMEIYLEQEESLTPEQ
FT                   LHAPLETALRHGELVPVCFASAEQQMGINHLLQILAQVLPNPQEANPPNFVNGWGDEAK
FT                   PVKLTLDEAGHLLAHVFRVSIDPYVGRLGVFRIHQGVLRTGQKLFIGADRKPIKVAHLV
FT                   KLQGKDQVEVTSAGPGDICALAKIDGLEVGAILHDHHEEDNFHMVDQDLPQPLFGLAVR
FT                   PKRRGDEQKLAEVLHKLVAEDPSLQISHDGVDNETVLQGLGDMHVQIALEKAQQVFNLD
FT                   MDTQKPSVAYRETITNSAESRYRHKKQSGGAGQFGEVHLKVEPLPRGSGFEFTSKVVGG
FT                   AIPSQFIPAIEKGVKEAMREGILAGFPMQDIRVVVLDGKHHPVDSKEIAFHMAGKKAFL
FT                   EAVMASSPVLLEPIVDMHVQVHQDKMGDITGDLSAHRAMVCGTQALANQQVDINAEAPL
FT                   AALDDYATRLKAMTGGEGQLSMAFSRYEVVPPNVQQQLMAH"
     atgcccgagc atcgcatcga acagataagg aatgcggctc tgatgggtca tagcggcagc        60
     ggcaaatcca gcttgctgga agccctgctc tatggcgcca gagccatcag tcaacgtggc       120
     agggtcgacg acggcactaa ccatgccgac ttcacccccc aggaaaaagc ccaccaccac       180
     agcctggaag cgtccttcct ctccctcgac cacaacgaca tccacatcaa tcttatcgac       240
     acccccggac tgcccgattt ctttggccgc gcccagctgg cgatgcctgc cgtggagagc       300
     gtcctgctgg tgatcaacgc cagccgtggt atcgaaccca ttgcccagcg cgcctttgaa       360
     gaggcccgac gccagggcaa atcgatcctg attgtggtga atcagatgga tggcaatgaa       420
     gcccagctgg agagcgtact ggaacagatc cagactcagt ttggccatgg ctgtctgccc       480
     ctgaacctgc cgaaagccga tggtaccggc gtggtggact gctacttcag cccggattac       540
     gacaccccga cccgctttgg cgatgtacgc agctgtcacg atgccctgat cgacaccgtg       600
     gtcgagcagg acgaagccct gatggagatc taccttgagc aggaggagtc gctgacaccg       660
     gagcagcttc acgcgccgct ggaaaccgcc ctgcgccacg gcgagctggt gccggtctgc       720
     tttgccagtg ccgaacagca gatgggcatc aaccacctgc tgcagatcct ggctcaggtc       780
     ctgcccaacc cgcaggaagc caacccgcct aatttcgtca acggctgggg tgatgaggcc       840
     aagccggtca aactgacgct ggacgaagcc ggccacctgc tggcgcacgt gttccgggtc       900
     agtatcgacc cctacgtggg tcgcctcggc gtgttccgta tccaccaggg ggtgctgcgc       960
     accggccaga agctgtttat cggtgccgac cgtaagccga tcaaagtggc ccatcttgtg      1020
     aagctgcagg gcaaagatca ggtggaggtc accagtgccg gccccggcga catctgcgcc      1080
     ctggccaaga tcgacggcct cgaagtgggt gccatcctgc acgaccacca cgaggaagat      1140
     aacttccata tggtcgatca ggacctgccc cagccgctgt ttggcctggc ggttcggccc      1200
     aagcgtcgtg gcgacgaaca gaagctggct gaagtgctgc ataagctggt ggcggaggat      1260
     ccgagcctgc agatcagcca cgatggggtg gacaacgaaa ccgtgctgca gggcctgggc      1320
     gatatgcacg tgcagatcgc actggagaaa gcccagcagg tgtttaacct cgatatggac      1380
     acccagaaac cctccgtggc ctaccgggaa accatcacca acagcgccga gtcgcgctac      1440
     cgccataaga aacagtccgg cggcgccggt cagtttggtg aagtgcatct gaaagtggaa      1500
     cccctgccgc gcggcagtgg ctttgagttc acctccaaag tggtgggtgg cgccatcccc      1560
     agccaattta tcccggccat tgagaaaggg gtgaaagagg cgatgcggga aggcatcctg      1620
     gccggcttcc cgatgcagga catccgcgtg gtggtgctgg acggcaaaca ccatccggtg      1680
     gactccaagg agatcgcctt ccatatggca ggcaagaaag ccttcctgga agcggtgatg      1740
     gcgtccagtc cggtactgct ggagccaatt gttgatatgc acgtgcaggt gcatcaggac      1800
     aagatgggtg acatcaccgg cgacctgagc gcgcaccgcg ccatggtgtg cggcacccaa      1860
     gccctggcca accagcaggt ggacatcaac gctgaagccc ctctggcggc gctggacgac      1920
     tacgccaccc ggttaaaagc gatgaccggc ggcgaaggcc aactgtcgat ggcgttcagc      1980
     cgttacgaag tggtgccgcc caatgttcag cagcagctga tggcccatta a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page