(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE77

CP002209.PE77        Location/Qualifiers
FT   CDS_pept        96724..97407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG5587 conserved hypothetical protein;
FT                   InterPro IPR012808; KEGG: pat:Patl_1742 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A2UVH2
FT                   Putative uncharacterized protein; PFAM: Conserved
FT                   hypothetical protein (DUF2461); TIGRFAM: conserved
FT                   hypothetical protein TIGR02453"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74291"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD7"
FT                   /protein_id="ADN74291.1"
FT                   /translation="MIPYIRPETLEFLEQLRVNNSRDWFQANKSRYEACVRGPALDLIA
FT                   SFAPRLASFAPRFRADAKKVGGSLMRPYRDTRFSHDKTPIKTNVGIQFRHDLGKDVHAP
FT                   GYYLHIEPGQCLLGVGCWRPDSPSLAAIREAIDRSPIRWLAARDDGEFCSRFSLSGTSL
FT                   VRPPKGYDKDHPQLEDLKRKDFIGVMPLADEQVMGEGLLDLMEEAYEGADPFMRFLCQA
FT                   MKVPF"
     gtgatcccct atatccgccc tgaaaccctc gaatttctgg agcaacttcg cgtcaataac        60
     agccgcgatt ggttccaggc caataagtcc cgttacgaag cctgtgtgcg tggcccggcg       120
     ctggacctca tcgccagctt tgcgccacgt ctggccagct tcgccccccg ttttcgtgcg       180
     gacgccaaaa aggtgggggg ctcgttgatg cggccctatc gcgacacccg tttttcccac       240
     gataaaaccc ccatcaaaac caatgtcggc atccagttcc gccatgatct gggcaaggat       300
     gtgcacgccc cgggctacta cctgcatatc gagccgggcc agtgtttgct gggggtgggg       360
     tgctggcggc cggattcccc gtcgctggca gcgattcggg aggccattga tcgctccccc       420
     atccgttggt tggcggcgcg ggatgacggc gaattctgca gtcggttcag cctgtccggc       480
     accagcctgg tgcggccccc caagggctat gacaaggacc acccccagct ggaggacctc       540
     aagcgcaaag actttatcgg ggtgatgccg ctggcggatg agcaggtgat gggggaggga       600
     ctgctcgacc tgatggagga ggcctacgag ggcgctgatc cctttatgcg gtttctctgt       660
     caggcgatga aagtgccgtt ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page