(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE79

CP002209.PE79        Location/Qualifiers
FT   CDS_pept        99369..99788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3126 conserved hypothetical protein; KEGG:
FT                   vha:VIBHAR_01451 hypothetical protein; SPTR: A3LED1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74293"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVD9"
FT                   /protein_id="ADN74293.1"
FT                   /translation="MKWQLPALLAIGALLGGCGGEAPSSAPQQESASMETITGQALYRE
FT                   RILLTPGTTMLVALEDVSRADAPAEVVSENRFEIQGPPPFAFALQYDPAKLVENHRYGL
FT                   RIRIEEKGELRFINDTHIDPFGDGLDQIVLKGVGR"
     atgaaatggc aactgccagc gctgctggct attggtgccc tgctcggcgg ctgtggtggc        60
     gaagccccca gctccgcgcc tcaacaggag agtgccagca tggaaaccat taccggacag       120
     gcgttgtatc gtgaacgcat tttgctgacc ccgggcacca ccatgctggt ggcgctggag       180
     gatgtgtccc gcgccgacgc gcccgccgag gtggtgagtg aaaaccggtt cgagatccag       240
     gggccgccgc cgttcgcgtt tgccctgcag tatgacccgg ccaagttggt ggagaatcac       300
     cgctacggcc tgcgcatccg catcgaagag aagggcgaac tgcgctttat caacgacacc       360
     cacatcgacc cgttcgggga cggtttggat cagatcgtgc tcaaaggcgt tggccgctga       420
//

If you have problems or comments...

PBIL Back to PBIL home page