(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE81

CP002209.PE81        Location/Qualifiers
FT   CDS_pept        complement(102258..102782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0081"
FT                   /product="Protein of unknown function DUF2058"
FT                   /note="COGs: COG3122 conserved hypothetical protein;
FT                   InterPro IPR018636; KEGG: ttu:TERTU_0971 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2058; SPTR:
FT                   A0YFM4 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2058)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74295"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVE1"
FT                   /protein_id="ADN74295.1"
FT                   /translation="MSLQDQLMKAGLVSKHDAKKANKDKHRARKAGKSVVNEAKAEAAQ
FT                   KRAEQAERDRQLNAERKAEAEKKALQAQIRQLITVNAQPRDKGDLAYNFSDQGSITKIY
FT                   VTPALQQGLINGQLAIAKLGQEYFLIAAAVAEKVAQRDASAIVLLNDKASDQPDEDDPY
FT                   ADYQIPDDLMW"
     atgtcactgc aggaccagct gatgaaagcc gggctcgtca gcaaacacga cgccaaaaag        60
     gccaataaag acaaacaccg tgcccgcaaa gcggggaaat cggtggtgaa tgaagccaag       120
     gctgaggccg cacaaaagcg cgctgaacag gccgaacgtg accgccagct caacgccgag       180
     cgcaaagcgg aagcggagaa aaaggccctg caggctcaga tccgccagct gatcaccgtc       240
     aacgctcagc cccgcgataa gggcgacctg gcctacaact tctcggatca gggcagcatc       300
     accaagatct acgtcactcc ggcactgcag caggggctga tcaacggcca actggccatc       360
     gccaagctgg gccaggagta cttcctgatc gccgcggcgg tcgcagagaa agtggcccag       420
     cgtgatgcca gtgccattgt cctgctcaac gacaaagcca gcgaccagcc ggatgaagat       480
     gatccctacg ccgattacca gatccctgac gacctgatgt ggtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page