(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE87

CP002209.PE87        Location/Qualifiers
FT   CDS_pept        107014..107892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0087"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG0053 Co/Zn/Cd cation transporter; InterPro
FT                   IPR002524; KEGG: saz:Sama_3430 cation efflux family
FT                   protein; PFAM: cation efflux protein; SPTR: A2UXD4 Cation
FT                   diffusion facilitator family transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74301"
FT                   /db_xref="GOA:E1SW01"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW01"
FT                   /protein_id="ADN74301.1"
FT                   /translation="MSSSTTPEQYAFWIRVATRASVATAVILILAKLLAWSFSGSASLL
FT                   ASLTDSMMDAMASLVNFYALRVALLPADQHHRFGHGKAEPLATLVQAGFILGSALLLLF
FT                   HGSERLINPTPLTNSTLGIGVSVFAMVATVVLLTIQKRAVAVTGSTAIAADALHYRTDL
FT                   LLNAAVLLALVLASQGLLWADGLFAVLIALYIGYGAWGLGSEAVQLLLDREAEPEVREQ
FT                   VEALAKADPGVQGLHDLRTRRSGNTLYVQMHLELDGDLPLREAHDLADAVECRIREAFP
FT                   GADVIVHQDPV"
     atgtcgtcct ccaccactcc tgagcaatac gctttctgga tccgtgtggc cacccgagcg        60
     tcggtggcca ctgcggtgat cctgatcctg gccaagctgc tggcctggtc tttctccggt       120
     tccgccagtc tgctggcctc cctgaccgac tccatgatgg acgcgatggc gtcactggtg       180
     aacttctacg ccctgcgcgt ggccctgctg cccgctgatc agcaccaccg ctttggccat       240
     ggcaaagccg agccgctggc gaccctggtg caggcgggct tcattctcgg ctcagccctg       300
     ttgctgctgt tccacggcag tgagcgcctg atcaacccca cccccctgac caactccacc       360
     ctcggcattg gcgtcagcgt cttcgccatg gtggcgacgg tggtgctgct gaccatccag       420
     aagcgtgcgg tggccgtgac cggttccacc gccattgccg ccgatgccct gcattaccgc       480
     accgatctgc tgttgaacgc cgctgtgctg ctggcactgg tgctggccag ccaggggttg       540
     ctctgggcgg atggtctgtt cgcggtgttg attgcactct acatcggcta cggtgcctgg       600
     gggctgggca gcgaagcggt gcagctgctg ctggatcgtg aagcggagcc ggaagtgcgt       660
     gaacaggtgg aagcgctggc caaagcggac cccggtgtgc aggggctgca cgatctgcgg       720
     acccgtcgct ctggtaatac cctctatgtg cagatgcacc tggagctgga tggcgacctg       780
     ccactgcggg aggctcatga tctggccgat gcggtggagt gccgcattcg cgaggcgttc       840
     cccggtgcgg atgtgattgt tcaccaggac ccggtctga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page