(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE89

CP002209.PE89        Location/Qualifiers
FT   CDS_pept        complement(109348..110403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0089"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /note="COGs: COG3852 Signal transduction histidine kinase
FT                   nitrogen specific; InterPro IPR004358: IPR013767:
FT                   IPR013656: IPR003594: IPR 003661: IPR000014: IPR005467;
FT                   KEGG: shw:Sputw3181_0222 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein; SPTR:
FT                   A2UXD7 Sensor protein; PFAM: Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74303"
FT                   /db_xref="GOA:E1SW03"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW03"
FT                   /protein_id="ADN74303.1"
FT                   /translation="MDRQSDPDYLHQLSTAVLVLTPQLQVRYANHAAEQLLGLGQRRLL
FT                   GQNAASLYSQLATDTALLRQTLEREQGQSLYAVSLVTLDGQHHTIDLIFTPLESAEILV
FT                   EARVVDHQQRISQELQHYAQQHAAQLLVRGLAHEIKNPLGGLRGAAQLLERELDDPELK
FT                   EFTTIIIEQSDRLRGLVDRLLGPQYPGTWAEGNVHRLLEQVARLCEMEATGTLVIERDY
FT                   DPSIPDFVMDAEQLQQALLNIVRNAVQALDGQGRIVLRTRSQGQTTIAGRRHRQVVAVS
FT                   VVDDGPGIDPSIQDTLFYPMVTNKADGSGLGLSIAQKIVSQHQGRIELESWPGHTEFTL
FT                   LLPMTFSKEAQ"
     atggaccgcc agtcggaccc agactatctg caccagcttt ccaccgccgt actggtgctg        60
     actccccagt tacaggtgcg ttacgccaat cacgctgccg agcaactgct cggcctcggg       120
     caacgccgcc tgctgggcca gaatgccgcc agcctctata gccagctggc caccgacacc       180
     gccctgctgc gccagacact ggagcgcgag cagggccaat ccctgtacgc cgtttctctg       240
     gtcaccctgg atggccaaca ccacaccatc gacctgatct tcaccccgct ggagagcgcc       300
     gagatcctgg tggaagcccg ggtggtggat caccagcaac gcatcagcca ggagctgcag       360
     cattatgccc agcaacacgc agcgcagctg ctggtgcgtg gcctggccca cgagattaaa       420
     aatccgctgg gcggtctgcg tggtgctgcc cagttgctgg agcgggagct ggacgacccg       480
     gaactcaaag agttcaccac catcatcatt gagcagtccg accgcctgcg tggcctggta       540
     gaccgactgc tgggtccgca atacccgggc acctgggccg agggcaatgt tcaccggttg       600
     ctggagcagg tggcccggct gtgcgagatg gaagccaccg gcaccctggt gatcgaacgg       660
     gactacgacc cctccatccc cgacttcgtg atggacgccg agcagctgca acaggcgctg       720
     ctcaatatcg ttcgcaacgc agtgcaggcg ctggatggtc agggacgcat cgtgttgcgc       780
     acccgcagcc agggccagac caccatcgcc ggtcggcgcc atcgtcaggt ggtagcggtc       840
     agcgtggtgg atgacggccc gggcatcgac cccagcattc aggacaccct gttctacccg       900
     atggtcacca ataaggctga cggcagtggc ctgggcttat ccatcgccca gaagatcgtc       960
     agccagcatc agggtcggat cgagctcgaa agctggcccg gccacaccga gttcaccctg      1020
     ctactgccga tgacgttttc caaggaggca caatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page