(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE93

CP002209.PE93        Location/Qualifiers
FT   CDS_pept        complement(114896..115978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_0782 hypothetical protein; SPTR:
FT                   A3JEK2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74307"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW07"
FT                   /protein_id="ADN74307.1"
FT                   /translation="MNIIIPIAGRSSRFPDMKPKWMLTHPQGDFMVVEAIKGLDLSNVR
FT                   RIVLVGLAQHEQEYGFVAALTAQFEALGIDDRVEFVLLEAQTRHQPETVARAIEQAHIE
FT                   GPIYIKDSDNYFVDTPRPGNLVACYDLHSLDNVNARNKSYLEVNADGHIINIVEKQIVS
FT                   STFCVGGYGFADAAQFMACFERLQAEPDLYLSHMIFQMVSDGETFGHQLVSDYVDWGTI
FT                   KEWNAYKAHYSTLFVDLDGTLVRNSAQFTEPKWGTTEAIADNVATLNALHASGTVQIII
FT                   TTSRKEAYRDVTVAQLERLGIRYDQLIMGLVHGRRIVINDYAKSNPYKSCDAINIKRNS
FT                   SDLKDKLEDSVGFHIDLGQR"
     atgaacatca tcatccccat cgccggccgc tcctcccgtt ttcccgatat gaaacccaag        60
     tggatgctga cccatcccca gggggacttt atggtggtgg aggcgatcaa ggggctcgac       120
     ctgagtaacg tgcgacgcat tgtgttggtg gggctggcgc agcatgagca ggagtacggg       180
     tttgttgcgg cgctgaccgc ccagtttgag gccctgggga tcgacgaccg ggtcgaattt       240
     gtgctgctgg aggcgcagac ccgccatcag ccggaaaccg tcgcccgcgc cattgagcag       300
     gcccacatcg aggggcccat ctacatcaaa gattccgaca actactttgt ggacaccccg       360
     cggccgggca acctggtggc ctgctacgac ctgcattcgc tggacaacgt caacgcccgc       420
     aacaagagct atctggaagt gaacgccgat ggccacatca tcaacatcgt cgaaaagcag       480
     atcgtctcca gcaccttctg cgtcggtggc tacggctttg ccgatgcggc tcagtttatg       540
     gcctgcttcg agcgcctgca ggcggagccg gacctctacc tgtcccacat gattttccag       600
     atggtgtccg atggggagac ctttggccat cagctggtga gcgactacgt cgactggggc       660
     accatcaagg agtggaacgc ctacaaggcc cactactcca cgctgtttgt ggacctcgac       720
     ggcactctgg tgcgcaactc ggcccagttt accgagccca agtggggcac caccgaggcg       780
     atcgccgaca acgtcgcaac gcttaacgcc ctgcacgcca gcggcaccgt ccagatcatc       840
     atcaccacct cccgcaagga ggcgtaccgt gacgtcaccg tggctcagct tgaacggttg       900
     gggatccgct atgaccagct gatcatgggg ctggtgcatg gccgacgtat cgtcatcaat       960
     gactacgcca agtccaaccc ctataagagc tgcgacgcca tcaacatcaa gcgcaacagc      1020
     agcgacctca aggacaaact ggaggactcc gtgggcttcc atatcgacct gggacagcgc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page