(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE94

CP002209.PE94        Location/Qualifiers
FT   CDS_pept        complement(115982..116836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0094"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="InterPro IPR002575; KEGG: maq:Maqu_0783 hypothetical
FT                   protein; PFAM: aminoglycoside phosphotransferase; PFAM:
FT                   Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74308"
FT                   /db_xref="GOA:E1SW08"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW08"
FT                   /protein_id="ADN74308.1"
FT                   /translation="MKPTVSGNSGCQLSLTQRNGVIVVQKRATTAAYAPRLRAQIDKQR
FT                   CAARRNRLPGVHIPAIVAEQPSPQGYCAWMEYLNYQDYSQFFATASLAKLDRLARHLID
FT                   FIEAELAEATLTEVPAQHFLDKLDAIARQLPGLANRDAKQAQLAALARRVKAQPVVLPL
FT                   GPNHGDLTLANLMVSQDASRIGLFDFLDSYLDSPLVDIAKVRQDTQFHWSRLMTRARID
FT                   RARYRIVMRYLDQQIDQHFHAYPWYRQHYTLIQGINIARIFPYEHQPQVSDFTHNTLTQ
FT                   LGF"
     atgaaaccca ccgtcagcgg caactcaggc tgccagctca gcctgaccca gcgtaatggc        60
     gttatcgtgg tgcagaagcg cgccaccacc gccgcctacg cgccccgact gcgtgcccaa       120
     atcgacaaac agcgctgcgc cgcccgccgc aatcgcctgc ccggcgtaca catccccgca       180
     atcgttgctg agcaaccctc ccctcagggc tactgcgcct ggatggagta cctgaactat       240
     caggattaca gccagttctt tgccaccgct tcgctggcca aactcgaccg gctggcgcgc       300
     caccttatcg attttattga agcggaactg gcagaagcga cgctgacgga agtgcccgcc       360
     caacactttc tcgacaagct ggatgccatc gcccggcaac tgcccgggct ggccaatcgc       420
     gatgctaagc aggcgcaact ggccgctctg gcccgccggg tcaaggcgca gccggtggtg       480
     ctgccactgg gccccaacca tggcgacctc actctggcca acctgatggt cagccaggac       540
     gccagccgca tcggcctgtt cgacttcctc gacagctatc tggactctcc gctggtggac       600
     atcgccaagg tgcgacagga cacccagttt cactggtcac ggctgatgac ccgggcccgc       660
     atcgaccgcg cccgctaccg catcgtgatg cgctacctcg accagcagat cgaccagcac       720
     ttccacgctt acccctggta tcgccagcac tacaccctga ttcagggcat caacatcgcc       780
     cgcatcttcc cctatgaaca ccagccccag gtgtccgact tcacccacaa caccctcact       840
     caacttggtt tttag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page