(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE95

CP002209.PE95        Location/Qualifiers
FT   CDS_pept        complement(117056..118075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0095"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="InterPro IPR020449: IPR000005: IPR018060; KEGG:
FT                   swp:swp_0094 transcriptional regulator, AraC family; PFAM:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; SPTR: A3LIF0 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74309"
FT                   /db_xref="GOA:E1SW09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW09"
FT                   /protein_id="ADN74309.1"
FT                   /translation="MKRLALWQDKCMDGQLLPLGLWQLFRLRQLDGEALLRGTGLFATD
FT                   LQHPGLRVSPRQLCALLSNARKLWPGDDLAFLLGQHWLPSQSGALTNGLLCAPDLERAL
FT                   SFWGRYHWLSQPWLRPTRWHQDDHSHWQLQLDLGLQTHHQFLLELALSTLTATAKRLSP
FT                   QPLHFHIQLPYPAPAHPHHYWKYLGPEVQFGAAMTRISLPRVELQRPLPGADLAGFQLA
FT                   WRQCRQRLQAEPWQRGLPAAVLARLERPQHQGDALPQVAKDLATSPATLKRRLKAFGLA
FT                   FQPLQDQARLGQALYLLSIQGAANADVARQLQFADGGNFRRSFKRWTGLLPSQFSRLT"
     atgaagcggc tggcgctgtg gcaggacaag tgcatggatg gtcagctgct gccgctgggg        60
     ctttggcaac tgtttcgcct gcgccagttg gacggcgaag cgctgttgcg tggcaccggc       120
     ctgtttgcca ccgacctgca gcaccctggc ctgcgggtat cgccacgcca gctctgcgcc       180
     ctgctcagca acgcccgcaa actgtggccg ggggatgatc tggcttttct gttgggccag       240
     cactggctgc ccagccagag tggtgccctg accaatggcc tgctttgtgc gccggatctc       300
     gagcgggcgc tgagcttttg gggtcgttac cactggctca gccaaccctg gctacggccc       360
     acccgctggc atcaggatga tcacagccat tggcaactgc agctcgacct ggggttgcag       420
     actcatcatc aatttctgct ggaacttgcc ctcagcaccc tgaccgccac cgctaagcgc       480
     ctttcaccgc agccactcca ctttcacatc cagctgccct acccggcgcc ggcccatccc       540
     caccattact ggaaatacct gggcccggag gtgcagtttg gcgccgccat gacccgcatc       600
     agcctgcccc gggttgagct gcagcgcccc ctgcctggcg ccgatctggc ggggttccag       660
     ctggcctggc gccaatgccg gcaacggctt caggccgaac cctggcagcg gggcctgccc       720
     gccgccgtgc tggcccggct tgagcgcccc cagcatcagg gcgatgcgct gcctcaggtc       780
     gccaaagacc tggccaccag ccccgcgacc ctgaagcggc ggcttaaagc gtttgggctg       840
     gcgttccagc ccctgcagga tcaggcccgg ctggggcagg ccctgtatct gctcagcatt       900
     cagggcgccg ccaacgccga tgtggcccgc cagcttcagt tcgccgacgg cggcaatttc       960
     cgtcgctcct tcaagcgctg gaccgggctg ctgcccagcc aattctcccg gttaacctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page