(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE97

CP002209.PE97        Location/Qualifiers
FT   CDS_pept        119255..121981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0097"
FT                   /product="TonB-dependent receptor"
FT                   /note="COGs: COG1629 Outer membrane receptor protein mostly
FT                   Fe transport; InterPro IPR000531: IPR012910: IPR010104;
FT                   KEGG: swp:swp_0096 TonB-dependent receptor, putative; PFAM:
FT                   TonB-dependent receptor plug; TonB-dependent receptor;
FT                   SPTR: A3WK30 Outer membrane protein; TIGRFAM:
FT                   TonB-dependent receptor; PFAM: TonB dependent receptor;
FT                   TonB-dependent Receptor Plug Domain; TIGRFAM:
FT                   TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74311"
FT                   /db_xref="GOA:E1SW11"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:E1SW11"
FT                   /protein_id="ADN74311.1"
FT                   /translation="MWKLNTYLLLLGAGLCASVNAAGRVEGQVTDADSRLPLAGAQVKI
FT                   EELGLSQSAGRDGRFLFPQVAPGQYTLVVDYLGAGSARLVIDVVDEQTLRQSVTLTGPT
FT                   ERIEVVGQRGSLSRSLNRQRAADNLVSVISADALGQFPDTNVSEALQRVPGVSIERDQG
FT                   EGRFVRVRGMAPDYNAVSMNGARLPAPENDRRAVALDVIPSDLLETLEVTKTLTPDMDA
FT                   DSLGGAVEVKSLSAFDRDDTYLNLSAEGSYDSQTENTSPKLAATYSDRYADDKVGMALA
FT                   LSWYDREFGSDNVETGGKWDFDDAALLEEVEQRDYQIQRERLGVGVNLDFRPNDNNDLY
FT                   LRTLYSRFTDDETRNANVVEWEEGQPQDSAAPADVTRELKSRTEEQEIASLVGGGEWRG
FT                   ERWTLNYQGSWSRAEADKPRFIDGAKFEAGVEDVGYQGTRDIRLTAPDAFYDPAEFELA
FT                   EVEIGESAARDTLAEGKFDVSRDLGLNRYPGAIQFGGKYSAREKRNRETVWIYEDFEEQ
FT                   GVDPARLSMVGYAGSELDYQLGRFGPGIESAGVWELVNSLSADDALDEVESTINDFDID
FT                   EDLAAGYLMGHLDVGQLRLLAGVRYERVDRDARGYGYNDVTEAFEPVRVENDEEHWLPG
FT                   VHLKYQLGEKTQIRGAWSNTLVRPTFGQLAPGFLIEEDDGDLEVAFGNPELQSLESMNW
FT                   DLAIEHYLGGVSVLSANLFYKDIENFIYRADLGGWGAYTDFAVADTFVNGDDAELYGAE
FT                   LAYVQQFTFLPEPLQGLLFSANATWSDSTARIDWVDDGQRQGRDIPLPSQSDLTANVSL
FT                   GYENAYVSLRLSAAYKSEYLVEVDALDDAAFDIYEDEHLQWDLVAKGFVTTDFIVYFKA
FT                   INLTDEPFYTYTGQSSYNAQYEQYGRTFQLGVQYTNF"
     atgtggaagt tgaacaccta cctgctgctg ctcggtgccg gtttgtgcgc cagcgtaaac        60
     gccgcaggac gcgttgaggg acaggtaacg gatgccgaca gccgcctgcc actggccggg       120
     gcccaggtga agattgagga gctgggactg tcccagtccg ccggccggga tgggcgattt       180
     ctgtttcctc aggtcgctcc gggccaatac accctggtgg tggattacct cggggcgggc       240
     agcgcccgac tggtgatcga tgtggtggac gagcagaccc tgcgccagag tgtcaccctg       300
     accggcccca ccgagcggat tgaggtggtg ggccagcgcg gctcgttgag tcgctccctt       360
     aaccgtcagc gcgcagccga caatctggtc agcgtgatca gtgcggatgc gctgggccag       420
     ttcccggaca ccaacgtcag tgaagccctg caacgggtgc cgggggtgtc gattgagcgt       480
     gaccagggcg aaggccgctt tgttcgggta cggggtatgg caccggacta caacgcggta       540
     tcgatgaacg gagcccgcct gccggcgccg gagaatgacc gccgggccgt ggcgctggac       600
     gtcattcctt ccgatctgct ggaaactctg gaggtaacca aaaccctgac cccggacatg       660
     gacgcggact cccttggtgg tgccgttgag gtcaagagtc tgtccgcctt tgaccgcgac       720
     gacacctacc tcaacctcag tgctgaaggc agctacgaca gtcagaccga gaacaccagc       780
     cccaagctgg cggccaccta cagtgaccgc tatgcagacg ataaggttgg catggcgctg       840
     gccctgagct ggtatgaccg tgagttcggc tccgacaacg ttgaaaccgg tggtaagtgg       900
     gactttgatg atgctgccct gctggaagag gtggagcagc gggactacca gatccaacgc       960
     gagcgtctcg gggtcggggt caatctggat tttcgtccca acgacaacaa tgacctctat      1020
     ctgcgcactc tctacagccg ctttaccgat gatgaaaccc gtaacgccaa cgtggtggag      1080
     tgggaggagg ggcaacccca ggacagtgct gcgcccgccg atgtgacccg agaactgaag      1140
     tcccgtaccg aggagcagga gatcgcctcg ctggtagggg gtggagaatg gcgtggcgag      1200
     cgctggaccc tcaactatca gggcagctgg agtcgggctg aagccgacaa accgcgattt      1260
     atcgatggcg ccaagtttga ggcgggtgtt gaggatgtgg gttaccaggg cacccgggac      1320
     atccgcctga ccgccccgga tgcgttctat gaccccgctg agtttgagct tgctgaggtg      1380
     gagattggcg aaagcgctgc ccgggatact ctggctgaag ggaagtttga cgtctcccgc      1440
     gatctgggcc tgaaccgcta tccgggtgcc atccagtttg gcggcaagta cagcgcccgt      1500
     gaaaaacgca atcgtgaaac cgtttggatc tacgaagact ttgaagagca gggtgtagac      1560
     ccggcgcgac tgtcgatggt gggttacgcc ggcagtgaac tggactacca acttggccgg      1620
     tttggtccgg gcatcgaaag cgctggcgtg tgggagctgg tcaacagcct gagtgccgat      1680
     gacgcgctgg acgaggtgga gtccaccatc aacgattttg acatcgatga agacctggca      1740
     gccggttacc tgatgggcca tctggatgtg ggtcaattgc gcttgttggc cggggtgcgt      1800
     tacgaacggg tggaccgcga tgcccggggt tatggctata acgatgtgac cgaagccttt      1860
     gagccggtgc gggtggagaa cgacgaagag cactggctgc ccggtgtgca cctgaagtat      1920
     caactggggg agaaaaccca gatccgtggt gcctggagca acactctggt gcgtcccacc      1980
     tttggtcagt tggcgccggg cttcctgatt gaagaggacg acggtgatct ggaggtggcc      2040
     tttggtaacc ctgagctgca atccctggaa tcgatgaact gggacctggc gattgagcac      2100
     tacctggggg gcgtcagcgt gctgtccgcc aacctgttct acaaggacat cgagaacttt      2160
     atctaccgcg ccgacctcgg cggttggggc gcctacaccg actttgcggt ggcggacacc      2220
     ttcgtcaacg gggatgacgc cgaactgtac ggtgccgagc tggcctacgt tcagcagttt      2280
     acctttctgc cggaaccgct gcagggcctg ctgttcagcg ccaatgccac ctggagcgac      2340
     tccaccgccc gcatcgactg ggttgatgac ggccagcgcc aggggcggga cattccgctg      2400
     ccgagccagt ctgacctgac cgccaacgtg tcgctggggt atgaaaacgc ctacgtcagc      2460
     ctgcgtctgt ccgccgccta caagtccgag tatctggtgg aagtggacgc gctggacgat      2520
     gccgctttcg acatctacga ggatgagcac ctgcagtggg atctggttgc caagggcttc      2580
     gtcaccaccg actttatcgt ctacttcaag gccatcaacc tgaccgatga gcccttctac      2640
     acctacaccg gccagagcag ctacaacgcc cagtacgaac agtatgggcg gaccttccag      2700
     ctgggcgtgc agtacaccaa tttctaa                                          2727
//

If you have problems or comments...

PBIL Back to PBIL home page