(data stored in ACNUC7421 zone)

EMBL: CP002293.PE10

CP002293.PE10        Location/Qualifiers
FT   CDS_pept        18645..19997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0010"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: gwc:GWCH70_0010 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72866"
FT                   /db_xref="GOA:A0A0F6BHG5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG5"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADP72866.1"
FT                   /translation="MKRIKQKIIIIFLMIGLCFYFLPFHAAKAAVDPLNIEADAAILVD
FT                   ANTGRILYQKNIDTVLGIASMTKMMTEYLLLEAVKEKRVKWDQQYTPSDYVYRLSQDRA
FT                   LSNVPLRKDGKYTIRELYEAMAIYSANAATVAIAEIVGGSEQNFVKMMNEKANQLGLKG
FT                   YKFVNSTGLSNEDLKGFHPEGTNQSEENVMSARSVATLAYHLLKEYPEVLETASTPRKI
FT                   FREGTDDQIKMDNWNWMLPGLVHAYEGVDGLKTGYTEFAGYCFTGTAERNGVRFITVVM
FT                   NAKSNGKSTIEARFEQTRKLLDYGFSNYSMKKLYSKGYELKGKSVLPVVKGKEKSVAIA
FT                   TDKPLSLVVKNGEEKNYRPVYVFDKKKLTADGELTAPVKKGEKVGYMTLQYKGEEEYSF
FT                   LSPEMKKNVSVDIVAKNNVEKANWFVLTMRGIGGLFGDVWTSVAKTVKGWF"
     gtgaagagga taaagcaaaa aataatcatt atttttctga tgattggttt atgtttttat        60
     ttcctgccat tccatgcggc aaaagcggca gtcgatccat tgaacattga agcggatgcg       120
     gcgatacttg tggatgctaa tacagggaga attttgtatc aaaaaaacat tgataccgtt       180
     cttggcattg ccagcatgac aaaaatgatg accgagtatt tgctgttgga agcggtcaaa       240
     gaaaaacggg taaaatggga tcagcagtat acaccaagcg actacgttta tcgtctttcg       300
     caagatcgcg ctttgtcgaa cgttccgtta cgaaaagatg ggaaatacac tatccgcgag       360
     ctttatgaag cgatggcgat ttattccgcc aatgctgcta cggtagccat tgctgaaatt       420
     gtcggtggtt cggaacaaaa ttttgtaaaa atgatgaatg aaaaagcaaa tcaattaggg       480
     cttaagggat ataaatttgt caactccaca ggactaagca atgaagattt aaaagggttt       540
     catccggagg gaacgaacca gagcgaagag aatgtgatgt ctgcccgttc cgtcgctaca       600
     ctagcgtatc atttgttgaa agaatatccg gaagtattgg aaacagcaag tacgcctcgg       660
     aaaatatttc gcgaaggaac agatgatcaa attaagatgg ataactggaa ctggatgctc       720
     cctggattag ttcatgcata cgaaggggtc gatggtctaa aaacggggta tacagaattt       780
     gccggttatt gttttacagg aacggcagag cggaatggcg ttcgttttat tactgttgtg       840
     atgaatgcga aaagcaatgg gaagtcgacg attgaagcac ggtttgaaca aacgagaaaa       900
     ttgcttgatt atggattcag caattattct atgaaaaaac tgtactcaaa aggatatgaa       960
     ctaaaaggaa aatcggtgtt gccagtagtg aaagggaaag aaaaatctgt cgccatcgca      1020
     accgataagc cgctttctct tgttgtgaaa aacggagagg aaaaaaacta ccgtcctgta      1080
     tatgttttcg ataaaaagaa attaaccgcc gacggcgagc taaccgcacc ggtgaaaaaa      1140
     ggagaaaaag tcggatatat gacattgcaa tataaaggag aagaggaata tagcttttta      1200
     agcccggaaa tgaaaaagaa tgtaagtgtc gatattgtgg caaaaaacaa tgttgaaaag      1260
     gcaaactggt ttgtgcttac aatgagagga atcggcgggc tgtttggcga tgtatggaca      1320
     agtgtagcca aaacggttaa aggctggttt taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page