(data stored in ACNUC7421 zone)

EMBL: CP002293.PE100

CP002293.PE100       Location/Qualifiers
FT   CDS_pept        120792..121160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: gtn:GTNG_0096 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72956"
FT                   /db_xref="GOA:A0A0F6BHQ5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ5"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADP72956.1"
FT                   /translation="MTKEQIIEAIKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA
FT                   GGDAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEGVSKEE
FT                   AEEIKAKLEEVGASVELK"
     atgacgaaag aacaaatcat tgaagcgatt aaaaatatga cagtattaga attaaacgaa        60
     ttagtaaaag caattgaaga agagttcggc gtaactgctg ctgctcctgt agtagttgct       120
     ggcggtgctg ctgctggcgg cgatgctgct gctgaaaaaa cagaattcga tgttatcctt       180
     gctgacgctg gtgctcaaaa aattaaagtt atcaaagtgg ttcgtgaaat cactggcctt       240
     ggcttgaaag aggcaaaaga cttagttgac aacactccaa aaccacttaa agaaggcgtt       300
     tctaaagaag aagcagaaga aatcaaagcg aaacttgaag aagttggcgc tagcgtagaa       360
     ttaaaataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page