(data stored in SCRATCH zone)

EMBL: CP002293.PE102

CP002293.PE102       Location/Qualifiers
FT   CDS_pept        122087..125659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="KEGG: gwc:GWCH70_0103 DNA-directed RNA polymerase,
FT                   beta subunit; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72958"
FT                   /db_xref="GOA:A0A0F6BHQ7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ7"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADP72958.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYKWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSEKVDKNGKRGFSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTIENAKNLLISRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEVIAEKGTIVDRRTLNRILPYLENGVGLRVHKPFGGVVEE
FT                   EIALQSIKIYAPNDPDGEQVINVISNGYIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSARDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGMPRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEKEINMENFDEEDDVHSA
FT                   DSLVPEVKSAEDEKAGKKGVATKE"
     ttgacaggcc gactagttca atatggacga caccgccaac gaagaagtta cgcgcgtatc        60
     agtgaagtgc tggaattgcc aaatcttatt gagattcaaa cttcctctta taaatggttt       120
     cttgacgaag gattgcggga aatgttcaga gaaatttccc cgattgagga cttttccggc       180
     aatctttctc ttgagtttat cgattatagt ttaggggagc caaaatatac tgttgaagag       240
     gcgaaagaac gcgatgttac atatgccgcg ccgcttcgtg ttaaagtgcg tttaattaac       300
     aaagaaactg gcgaagtaaa agaacaagat gtctttatgg gcgatttccc gttaatgaca       360
     gaaacgggaa cgtttatcat taacggggcg gaacgtgtta ttgtttccca gcttgtccgc       420
     tcaccaagcg tttattatag cgaaaaggtt gataaaaatg gaaaacgcgg tttttcggca       480
     acggtcattc cgaaccgcgg ggcatggctg gaatatgaaa cagatgcaaa agatgttgtg       540
     tatgtccgta ttgaccgcac tcgtaaacta ccagtgacgg ttcttctgcg cgctcttggc       600
     tttggctctg accaagaaat tatcgattta atcggtgata acgaatatct tcgcaacacg       660
     ctcgaaaagg ataatacaga cagcacggaa aaagcgttaa tcgagattta cgagcgtttg       720
     cgtccagggg aaccgccgac gattgaaaac gcaaagaatt tgttaatctc ccgcttcttt       780
     gatccaaagc gttatgactt ggcaagcgtc ggacgttata aaattaataa aaagctccat       840
     attaaaaacc gtctgtttaa ccaacgcctt gccgaaacat tggtggatcc tgaaactggc       900
     gaagtcattg cagaaaaagg aacgattgtt gatcggagaa cgttaaatcg aattttacca       960
     taccttgaaa acggtgttgg attgcgggtt cacaaacctt tcggcggcgt agtggaagaa      1020
     gaaattgcgc tgcagtcgat taaaatttat gcgccaaacg acccggacgg ggaacaagtg      1080
     attaatgtca ttagcaacgg ctacattgcc gaagacgtaa aacatattac tcctgcggat      1140
     attattgctt cgattagcta tttctttaat ttattgcatg gagtcggtga cacggatgat      1200
     attgaccatt taggaaaccg tcgtctccgt tctgtcggtg aattgttgca aaaccaattc      1260
     cggatcggtt tgtcgcgcat ggagcgggtt gttcgtgagc gcatgtcgat tcaggacaca      1320
     aacacgatca ctccgcaaca gctgatcaat attcgtccgg tcattgcggc gattaaagaa      1380
     tttttcggaa gctcgcagct ttcgcaattt atggatcaaa cgaacccgct cgctgaattg      1440
     acgcataaac gccgcctgtc tgccctaggt cctggtggct tgactcgtga acgggccggt      1500
     tttgaagtgc gtgacgtcca ctattcacat tatgggcgga tgtgtccaat tgaaacgcct      1560
     gaaggtccga acatcgggtt aattaactca ttgtctacgt atgcgaaagt gaataaattc      1620
     ggttttatcg aaacaccgta ccgccgcgtc gatccagaga cgggaagagt taccgatcaa      1680
     attgactatt taaccgctga cgaggaagat aactacgtcg tggcgcaagc gaacgttccg      1740
     ctcgcagaag atggaacgtt cttagaagaa aatgtggttg cccgtttccg cggcgaaaac      1800
     attgtcgtca aacgcgaccg cgttgactat atggacgtat cgccaaagca agtcgtatcg      1860
     gcagcgacgg cctgcattcc gtttttggaa aacgatgact cgaaccgcgc gctgatgggt      1920
     gcgaacatgc agcgtcaagc cgttccgctg ttagaaccgg aagcgccgat tgtcggcacg      1980
     ggaatggaat acgtgtccgc gagagattcc ggcgccgctg ttatctgtaa acatcgaggc      2040
     attgtcgaac gggtagaggc gaaagaaatt tgggttcgcc gtctcattga agtggacgga      2100
     aaagaagtga aaggtgatct tgataaatat cgcctgttga aattcgtccg ctccaaccaa      2160
     ggaacttgct acaatcaacg tccgattgtg aaaaagggcg atatcgtaga aaaaggcgag      2220
     attttggcgg acggaccgtc catggataaa ggcgagcttg cccttggccg caacgtgctt      2280
     gttgccttta tgacatggga tggctacaac tatgaagacg cgattatcat gagcgaacgt      2340
     ctcgttaaag aagacgtcta tacgtccatt catattgaag agtatgaagc ggaatcccgc      2400
     gacacaaaac ttggtccgga agaaattacg cgcgacattc cgaacgtcgg cgaggatgcg      2460
     ctgaaaaact tagatgagcg cggaatcgtc cgcattggcg ccgaggtaaa agacggcgac      2520
     ttgcttgttg gaaaagtaac gccaaaagga atgacagaac tgacggcaga agagcggctg      2580
     ctgcatgcga tcttcggtga gaaagcccgc gaagtgcgcg atacgtctct tcgcgttccg      2640
     catggcggcg gcggcatagt ccttgacgtg aaggtcttta accgtgaaga cggagatgaa      2700
     cttccgccag gcgtcaacca gcttgtccgt gtttatatcg tacaaaagcg gaaaatttcc      2760
     gaaggcgata aaatggcagg acgccatgga aacaaagggg ttatttcgcg gattttgccg      2820
     gaggaagata tgccgttctt gccagatggc acgccaattg atattatgtt gaatccttta      2880
     ggcgttccat cgcggatgaa tatcgggcaa gtgtttgagc tgcatctcgg tatggcggcg      2940
     aaaaagctcg gtcttcatat tgcgtccccg gtattcgatg gggctacaga agaagatgta      3000
     tggaacattt tagaagaagc tggaatgccg cgtgacgcaa aaacggtgtt atatgatggc      3060
     agaacgggag aaccgtttga taaccgtgta tctgtcggta ttatgtacat gattaagctt      3120
     gcgcacatgg tcgacgataa gctgcacgcc cgctcaacag gaccgtactc gctcgttacg      3180
     caacagccgc tcggcggtaa agcgcaattt ggcggacagc gctttggcga aatggaagtg      3240
     tgggcgcttg aagcttatgg tgctgcgtat acattgcaag aaatacttac agtcaagtcg      3300
     gacgatgtcg tcggccgtgt caaaacgtac gaagcgattg taaaagggga aaacattcca      3360
     gaaccaggtg tgccggaatc gtttaaagtg ctgataaaag agctgcaaag cttaggtatg      3420
     gatgtcacca ttttgactag cgatgagaaa gaaattaata tggaaaactt tgatgaagag      3480
     gatgacgttc attctgcgga ttcgcttgtc ccggaagtaa agtcggcaga agatgaaaaa      3540
     gccgggaaaa aaggtgttgc gacaaaagaa taa                                   3573
//

If you have problems or comments...

PBIL Back to PBIL home page