(data stored in SCRATCH zone)

EMBL: CP002293.PE103

CP002293.PE103       Location/Qualifiers
FT   CDS_pept        125791..129390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; RNA polymerase Rpb1 domain 5; KEGG:
FT                   gwc:GWCH70_0104 DNA-directed RNA polymerase, beta' subunit;
FT                   SMART: RNA polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72959"
FT                   /db_xref="GOA:A0A0F6BHQ8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHQ8"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADP72959.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   QSFQASMGAEAIKKLLQDIDLEKEVATLKEELKTAQGQRRARIIKRLEVLEAFRNSGND
FT                   PAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHSRIAVHAGSLKNETFTEEQNNKLLITTVGKLIFNEILPNSFP
FT                   YINEPTTENIEGRTPDKYFLDKGVNVKEEIRKRELVPPFKKKVLGQIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILEEAQTKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQDRLMKSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREEDCGTDRGILARALTDGTEVIVKLEERLVGRYAQKTVRHPETGEILVRKDEMITED
FT                   IANAIVKAGIKEVWIRSAFTCNTRHGVCKKCYGRNLATGAEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGIVTSISETRDRQY
FT                   EIVVKGEVETRSYIAPYNARLKVEEGQQVERGQELTEGSIDPKQLLKVRDVTSVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRIIDAGDTDVLPGTLLDVHQFTDVNEKAL
FT                   LEGKRPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPVVKKEENEDAVTSK"
     ttgctagatg ttaataaatt tgaatacatg aaaatcggac tcgcttcgcc ggaaaaaatt        60
     cgttcttggt catatggtga agtaaaaaaa ccggaaacga ttaactatcg cacattgaaa       120
     ccggaaaaag acgggttgtt ttgtgaacgt attttcggcc cgacaaaaga ttgggaatgt       180
     cattgtggaa aatataagcg cgtacgttac aaaggtgttg tctgtgatcg ttgcggtgtc       240
     gaagtaactc gctcgaaagt ccgtcgcgaa cggatgggac atattgaact agcagctcct       300
     gtttcacata tttggtattt caaagggatt ccgagccgca tggggcttgt tttggacatg       360
     tcgccgcgcg cgttagaaga ggtcatttat ttcgcttcat atgttgtgac tgatccaggc       420
     gatacaccgc ttgagaaaaa acaattgctt tcggaaaaag aataccgcgc gtatcgcgaa       480
     aaatacgggc aatcattcca agcttccatg ggtgcggaag ccattaaaaa gcttcttcaa       540
     gatattgatt tagaaaaaga agtggcaacg ctcaaggaag aattaaaaac ggcgcaagga       600
     cagcggcgtg cccgaattat taaacggttg gaagtgttag aagcgttccg taattcagga       660
     aacgatcctg cttggatggt gcttgacgtg cttccagtca tcccgcctga attgcggccg       720
     atggtgcaat tagatggagg acgttttgcg acatctgacc tcaatgactt gtatcgccgc       780
     gttattaacc ggaataaccg gttaaaacgg ctgctggatc ttggtgcgcc aagcattatt       840
     gtgcaaaacg aaaaacggat gctccaagag gcggtcgatg cgctcattga caacggtcgc       900
     cgcggccgtc cggtaacggg acctgggaac cgtccgctta aatcgctgtc ccatatgtta       960
     aaaggaaagc aaggccgttt ccggcagaac ttgcttggta aacgtgtgga ttattcaggg      1020
     cggtcggtta ttgtcgtcgg tccgaacttg aaaatgtatc aatgcggttt gccaaaagaa      1080
     atggcgcttg agctctttaa accatttgtg atgaaagagc tggttgaacg cgggctcgcc      1140
     cataacatta aaagcgcaaa acggaaaatc gaacgcgttc atccggaagt atgggatgta      1200
     ttagaggacg tcattaaaga acatcctgtc ttgctcaacc gtgcgccaac gcttcaccgc      1260
     ttgggtattc aagcgttcga gccaacgctt gtcgaaggac gcgccatccg tttgcatccg      1320
     cttgtatgta cggcatataa cgctgacttt gacggagacc aaatggcggt gcacgttcca      1380
     ttatccgcgg aagcgcaggc ggaagcccgc ttgctcatgc tggctgcaca aaacattttg      1440
     aacccgaaag acggaaaacc ggttgttact ccttcgcaag acatggtttt aggtaactac      1500
     tatttaacga tggaacgcga aggggcgatc ggtgaaggaa tggtatttaa agatacggat      1560
     gaagcgctgc tcgcgtacca taacggttat gtccatctgc actcgcggat tgccgttcat      1620
     gctggctcat tgaaaaatga aacatttaca gaagaacaga ataacaaact gcttattaca      1680
     acagttggaa aactcatttt caatgaaatt ttgccaaact cgttcccata tattaacgag      1740
     ccgacaaccg aaaatatcga agggcggaca ccagacaaat atttccttga taaaggcgtg      1800
     aatgtcaaag aagaaattcg caagcgcgaa ctcgttccgc catttaagaa aaaagtgctt      1860
     ggacaaatta tcgctgaagt atttaagcgg ttcaaaatta cggaaacatc gaaaatgctg      1920
     gaccgcatga aagatttagg tttccaatat tcaacaaaag ccggcattac gattggtgtt      1980
     gccgacattg tcgtgctgcc agaaaaacaa gaaattcttg aagaagcgca gacgaaagta      2040
     gatacagttt taaaacaatt ccgccgcggt ttaattaccg acgaagagcg ttatgaacgg      2100
     gttatttcga tttggagcgc ggcgaaagat aaaattcagg acagattgat gaaatcgttg      2160
     gataaacgca acccaatctt tatgatgagc gattctggag cccgcggtaa cgcgtcgaac      2220
     tttacgcagc ttgccggaat gcgcggtctg atggcgaacc cggcaggacg catcatcgag      2280
     ttgccgatca aatcttcgtt ccgtgaagga ttaaccgtat tggagtactt tatttccaca      2340
     cacggggcac gcaaagggct tgctgatact gcgttgaaaa cagcggactc tggttatctc      2400
     acaagacgtc ttgttgacgt ggcgcaagat gtgattgttc gcgaagaaga ttgcggcacg      2460
     gaccgcggca ttcttgcaag agcattgacg gatggcacgg aagtcatcgt gaaactggaa      2520
     gaacgtcttg tcggccgtta cgcgcaaaaa acggtgagac atccagaaac gggtgaaata      2580
     ctcgttcgca aagatgagat gatcaccgaa gacattgcga acgcgatcgt gaaagccggc      2640
     attaaagaag tatggatccg ctctgccttt acatgcaata cgcggcacgg tgtatgtaaa      2700
     aaatgttacg gccgcaactt ggcaaccggt gcggaagtgg aagtcggcga agcagtcggc      2760
     atcattgctg cgcaatcgat cggcgagccg ggaacacagc tgacgatgcg tacattccac      2820
     acaggcggtg ttgctggcga cgacattacc caaggtttgc cgcgcgttca agagctgttt      2880
     gaagcgcgca atccgaaagg gcaagcggtg atttcagaaa ttgacggaat cgtcacatcg      2940
     attagcgaaa cgcgcgatcg ccaatatgaa atcgtcgtaa aaggcgaagt ggaaacgcgc      3000
     tcttatatcg ccccttacaa cgcaagatta aaagtagaag aagggcagca agtagagcgc      3060
     gggcaagaac tgacagaagg atcgattgac ccgaaacaat tattaaaagt aagggatgtc      3120
     acatccgttc aagaatactt attgcgcgaa gtgcaaaaag tatacagaat gcaaggggta      3180
     gaaattagcg acaaacatat cgaagtaatg gtccgacaaa tgcttcgcaa agtgcgcatc      3240
     attgacgcgg gagatacaga cgtcttgcct ggcacgttgt tagatgtgca tcaatttaca      3300
     gatgtgaacg aaaaagcgct tttggaagga aaacgtccgg cgacagctcg tccggtattg      3360
     ctcggtatta caaaagcatc gcttgagaca gattccttct tgtccgctgc atcattccaa      3420
     gaaacaacgc gcgttttaac agatgcggcg atcaaaggaa aacgagatga attgcttggc      3480
     ttaaaagaaa acgtcattat cggcaagctt gttccggcag gaacgggaat ggctcgctac      3540
     cgcaaagtga agccggtagt gaagaaagaa gaaaatgaag atgcggttac ttcgaaataa      3600
//

If you have problems or comments...

PBIL Back to PBIL home page