(data stored in ACNUC7421 zone)

EMBL: CP002293.PE105

CP002293.PE105       Location/Qualifiers
FT   CDS_pept        129875..130297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0105"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gwc:GWCH70_0106 ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72961"
FT                   /db_xref="GOA:A0A0F6BHR0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADP72961.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKVQTNVPSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDTAGVANRMQGRSKYGAKKPKESKK"
     atgcctacaa tcaaccaatt agtccgcaaa ggtcgcgaga aaaaagtggt aaaatcaaaa        60
     tctcctgcgt taaataaagg gtacaacagc ttcaaaaaag tgcaaacaaa cgttccttct       120
     ccgcaaaaac gcggtgtttg tactcgtgtt ggcacgatga cgccgaaaaa gccaaactct       180
     gcgcttcgta aatatgcgcg tgtccgttta acgaacggca ttgaagtaac ggcttatatt       240
     cctggaatcg gccataactt gcaagaacac agcgttgtac tgattcgcgg cggacgtgtt       300
     aaagacttgc caggggtacg ctatcacatc attcgtggtg cccttgatac agcaggggta       360
     gcgaaccgca tgcaaggtcg ttcgaaatac ggcgcgaaaa aaccaaaaga atcgaaaaaa       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page