(data stored in SCRATCH zone)

EMBL: CP002293.PE107

CP002293.PE107       Location/Qualifiers
FT   CDS_pept        130948..133026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0107"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; elongation
FT                   factor Tu domain 2 protein; elongation factor G
FT                   domain-containing protein; KEGG: gwc:GWCH70_0108
FT                   translation elongation factor G; SMART: elongation factor G
FT                   domain IV; elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72963"
FT                   /db_xref="GOA:A0A0F6BHR2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR2"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADP72963.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVNTLHERLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIEIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEITVEELKAAIRRATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPPIKGIVPDTEEEVVRESSDDAPFAALAFKIMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   MNSTKRKRERIGRLLQMHANHRQEISTVYAGDIAAAVGLKDTTTGDTLCDEKNLVVLES
FT                   MEFPEPVINVAIEPKSKADQDKMGQALQKLQEEDPTFRAWTDPETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAAEKCDPVLLEPIMKVEVIIPEEYLGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATSLRSNTQGRGTFTMVFDHYEEVPKNIADEIIKKNKGE"
     atggcaagag agttctcctt agaaaaaact cgaaacattg gtattatggc gcatattgac        60
     gccggtaaga caacgacaac cgagcgcatc ttgttctaca caggccgcgt tcataaaatt       120
     ggcgaagtgc atgaaggcgc ggcaacaatg gactggatgg aacaagaaca agagcgcgga       180
     attacgatta catctgcggc gacaacagcg caatggaaag ggcatcgcat taacatcatc       240
     gacacgccag ggcacgtaga cttcactgtg gaagttgaac gttctctccg cgtgcttgac       300
     ggtgcgatta ctgttcttga tgcgcaatct ggtgtagaac cgcaaacaga aacggtatgg       360
     cgccaagcga ctacgtacgg cgttccgcgc atcgtgttcg tcaacaaaat ggataaaatc       420
     ggtgcggatt ttctatattc tgtgaatacg cttcatgaac gcctgcaagc aaacgcgcac       480
     cctgtgcaat tgccgatcgg cgcggaagac caattctctg gcattattga tcttgttgaa       540
     atgtgcgcgt accattatca cgatgagctt ggcaaaaata ttgagcgcat cgaaattcct       600
     gaagagtacc gcgacatggc ggaagaatat cataacaaac tcatcgaagc agttgctgaa       660
     ttagatgaag agcttatgat gaaatattta gaaggggaag aaattacagt agaagaatta       720
     aaagcagcga ttcgcagagc gacgatcagc gtagaattct tccctgtgtt ctgtggttct       780
     gcatttaaaa acaaaggggt tcaattattg cttgacggag ttgttgacta tttgccttct       840
     ccggtggata tccctccaat taaagggatc gttccagata cggaagaaga agttgttcgt       900
     gaatcaagcg atgatgcccc atttgcagcg ttagcgttta aaattatgac agacccttat       960
     gttggtaagt taacgttctt ccgtgtatac tctggtacgc tagattctgg ttcatatgtc      1020
     atgaactcga caaaacgcaa acgcgaacgc attggtcgtc tcctgcaaat gcatgcgaac      1080
     caccggcaag aaatttcaac agtatatgct ggtgacatcg cggcagctgt aggtttaaaa      1140
     gatacaacaa caggcgatac tctttgtgat gaaaagaatc ttgttgtgtt agaatccatg      1200
     gaattcccag aaccagtaat taacgtagcc atcgagccaa aatccaaagc ggaccaagat      1260
     aaaatggggc aagcgttgca aaaattgcaa gaagaagacc caacattccg cgcttggaca      1320
     gacccagaaa ctgggcaaac gatcattgct ggtatgggtg agctccatct tgacatcatc      1380
     gttgaccgta tgcgccgtga atttaaagtg gaagcaaacg tcggtgctcc gcaagttgct      1440
     taccgcgaaa cattccgcaa atcggcgcaa gtcgaaggga aatttatccg ccagtctggt      1500
     ggtcgcggtc aatacggtca cgtttggatc gagttctcgc caaacgaacg cggaaaaggt      1560
     ttcgaattcg aaaacgcgat tgtcggtggg gtcgttccga aagaatatgt tccagccgtt      1620
     caagctggtc ttgaagaagc aatgcaaaac ggcgttcttg ccggatatcc ggttgttgac      1680
     attaaagcga aactatttga tggttcatac catgatgttg actccagcga aatggcattt      1740
     aaaattgctg cgtctttagc attgaaaaac gcggcagaaa aatgcgaccc tgtgttgctt      1800
     gaaccaatca tgaaagttga agtaattatt ccagaagaat atcttggcga tattatgggc      1860
     gacatcactt ctcgccgtgg acgcgtagaa ggtatggaag cccgcggcaa cgcgcaagtt      1920
     gtccgcgcga tggttccgct agcagaaatg tttggatacg ctacttcact ccgttctaac      1980
     acacaaggtc gcggaacgtt cacaatggta tttgaccatt atgaagaagt tccgaaaaac      2040
     attgcagatg aaatcatcaa aaaaaataag ggtgaataa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page