(data stored in ACNUC7421 zone)

EMBL: CP002293.PE109

CP002293.PE109       Location/Qualifiers
FT   CDS_pept        134649..134957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0109"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: gwc:GWCH70_0110 ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72965"
FT                   /db_xref="GOA:A0A0F6BHR4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR4"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADP72965.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL"
     atggcaaaag aaaaaattcg tattcgttta aaagcttatg atcatcgaat tcttgatcaa        60
     tctgcggaaa aaatcgtaga aacagcgaaa cgttccggcg caaaagtatc tggtccgatt       120
     ccattgccga cggaaagaac tgtttatacg attttacgcg ctgttcacaa gtataaagac       180
     tctcgtgaac aattcgaaat gcgtacacat aaacgcttga tcgatatcgt gaatcctact       240
     ccgcaaacgg tggattcgtt aatgcgtctt gacttgccgt ctggtgtcga tattgaaatt       300
     aaactttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page