(data stored in ACNUC7421 zone)

EMBL: CP002293.PE11

CP002293.PE11        Location/Qualifiers
FT   CDS_pept        20146..21030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0011"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="KEGG: gwc:GWCH70_0011 pyridoxine biosynthesis
FT                   protein; TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72867"
FT                   /db_xref="GOA:A0A0F6BHG6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG6"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ADP72867.1"
FT                   /translation="MAITGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMKAVSIPVMAKARIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVSMSEDELVTEAKNLGAPVEVLREIKQLGRLPVVNFAAGGIATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATAHYEDYELIAHLSKGLGGAMRGIDVA
FT                   SLLPEQRMQERGW"
     atggcgatta caggtacaga ccgtgtcaaa cggggaatgg cggaaatgca aaaaggcggc        60
     gtcatcatgg acgtggtgaa tgcggaacaa gcgaaaatcg cggaagcggc cggtgcggta       120
     gcggtgatgg cattggaacg tgttcctgct gacattcgtg ctgccggtgg agtcgcgcgc       180
     atggcggatc cgacggttat tgaggaagtg atgaaggccg tgtcgattcc tgttatggca       240
     aaggcacgta tcggccatta cgtggaggcg cgcgttcttg aggcgctagg cgttgattat       300
     attgatgaaa gcgaagtatt aacaccagcg gacgaagaat tccatattga taaacggcaa       360
     tttaccgttc cgtttgtttg cggttgccgc gacttaggag aagcagcccg acgcattgcc       420
     gaaggggcat cgatgctgcg cacaaaaggg gaaccaggta caggaaacat tgttgaagca       480
     gtgcgccata tgcgcaaagt caatgcgcaa attcgcaaag tcgtcagcat gagtgaagat       540
     gaacttgtga cagaagcaaa aaatttaggc gctcctgtcg aagtattgcg tgaaattaaa       600
     caattgggcc gtctccctgt tgtcaacttt gccgctggcg gtatcgcgac tccggctgac       660
     gcggcgttga tgatgcattt aggcgcagat ggagtgtttg tcggttcggg aatttttaaa       720
     tcggaaaatc cggaaaaata cgcgcgggcg atcgttgaag cgacagccca ttatgaagat       780
     tacgagctaa tcgctcattt atccaaaggg ttaggtggcg caatgcgcgg tattgatgtc       840
     gcgtcattat tgccagaaca acgtatgcaa gagcgtggtt ggtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page