(data stored in ACNUC7421 zone)

EMBL: CP002293.PE112

CP002293.PE112       Location/Qualifiers
FT   CDS_pept        136266..136553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0112"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: ribosomal
FT                   protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72968"
FT                   /db_xref="GOA:A0A0F6BHR7"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR7"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADP72968.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLISQKKYTFEVDVNANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
     atgaaagatc ctcgcgacat tattaagcgc cccattatca cggaaaacac gatgaattta        60
     atttcgcaaa aaaaatatac atttgaagtc gacgttaatg cgaataaaac agaagtgaaa       120
     gacgcagtag agaaaatttt tggcgtgaaa gtagcaaaag tcaacattat gaactataaa       180
     ggaaaattca aacgcgttgg ccgttacagc ggttatacaa accgtcgccg taaagcgatc       240
     gtaacgttaa cgccagacag caaagagatc gaactgtttg aagtataa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page