(data stored in ACNUC7421 zone)

EMBL: CP002293.PE113

CP002293.PE113       Location/Qualifiers
FT   CDS_pept        136581..137411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0113"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: gwc:GWCH70_0114 ribosomal protein L2; TIGRFAM:
FT                   ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72969"
FT                   /db_xref="GOA:A0A0F6BHR8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHR8"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADP72969.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDKPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRLYRIIDFKRDKDGIPGRVATIEYDPNRSANIALIHYADGEKRYI
FT                   IAPKNLKVGMEIMSGPDADIKVGNALPLENIPVGTLVHNIELKPGKGGQLVRAAGTSAQ
FT                   VLGKEGKYVIVRLASGEVRMILGACRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGFKTRKKNNKSDKFIIRRRKK"
     atggcaatca aaaaatacaa accgacctcc aacggtcgtc gtggtatgac agttcttgac        60
     ttctccgaaa ttacaacaga taagccggaa aaatcgttgc ttgcaccgtt aaagaaaaaa       120
     gctggtcgca ataaccaagg aaaaattaca gtacgccatc aaggcggcgg tcataaacgc       180
     ctatatcgca tcatcgactt taaacgcgat aaagatggaa ttccaggtcg cgttgctaca       240
     atcgagtatg atcctaaccg ttccgcaaac attgcgttaa ttcactatgc agatggtgaa       300
     aaacgttata ttattgcgcc gaaaaacctt aaagtaggca tggaaatcat gtctggccca       360
     gacgcagaca ttaaagttgg caacgcattg ccgcttgaaa atatcccagt tggtacgctt       420
     gtgcataata tcgagctgaa accaggaaaa ggcggacaat tagttcgcgc tgctggtaca       480
     tctgcgcaag tgcttgggaa agaaggaaaa tatgtcatcg ttcgccttgc atctggcgaa       540
     gtgcgcatga ttttaggtgc ttgccgggca acagttgggg aagttggcaa tgagcagcac       600
     gaacttgtga atatcggtaa agcaggtcgc gctcgttggt taggcattcg tccaaccgtt       660
     cgcggttctg ttatgaaccc tgttgatcac ccgcacggtg gtggtgaagg taaagcgcca       720
     atcggacgca agtcaccaat gactccttgg ggtaaaccga cgcttggctt taaaacacgc       780
     aaaaagaata acaaatcgga taaattcatt atacgtcgtc gtaaaaaata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page