(data stored in SCRATCH zone)

EMBL: CP002293.PE116

CP002293.PE116       Location/Qualifiers
FT   CDS_pept        138111..138767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0116"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: gwc:GWCH70_0117 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72972"
FT                   /db_xref="GOA:A0A0F6BHS1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS1"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADP72972.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWDSRWYAEKDYADLLHEDLKIREYINKR
FT                   LQDAAVSRIEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALTQLTGKRVHINIVE
FT                   IKKPDLDAKLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYATAEADTTYGKIGVKVWIYRGEVLPKKKKTEEGGK"
     gtgggtcaaa aggtaaatcc gatcggtctc cgcatcggca ttattcgtga ctgggactct        60
     agatggtacg ctgaaaaaga ttatgcggac cttttacatg aggatctcaa aatccgtgag       120
     tatattaata aacggttgca agacgccgca gtatctcgca ttgaaattga acgtgcagca       180
     aaccgcgtca acattacgat ccatacagca aaaccaggca tggtgatcgg aaaaggcggt       240
     tcagaagtag aagcgcttcg caaagcgttg acacaattaa ctggcaaacg tgttcacatt       300
     aacatcgttg aaatcaaaaa accagattta gatgcgaaac ttgttgcgga aaacattgcg       360
     cgccaattag aaaaccgcgt ttccttccgc cgtgcgcaaa aacaagcgat tcaacgggca       420
     atgcgcgcag gggcaaaagg aattaaaaca atggtatccg gtcgtctcgg cggtgctgat       480
     atcgcgcgct ctgaacatta cagcgaagga actgttccac tccatacgct tcgtgcagac       540
     atcgattatg caacggcaga agcggataca acctatggaa aaatcggcgt gaaagtatgg       600
     atttatcgtg gagaggtcct tccgaaaaaa aagaaaactg aggaaggagg aaaataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page