(data stored in SCRATCH zone)

EMBL: CP002293.PE119

CP002293.PE119       Location/Qualifiers
FT   CDS_pept        139424..139687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0119"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gwc:GWCH70_0120 ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72975"
FT                   /db_xref="GOA:A0A0F6BHS4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS4"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADP72975.1"
FT                   /translation="MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDENNIAKVGDIVKIMETRPLSATKRFRLVEIVEKAVIV"
     atgagtgagc gcaatcaacg caaagtgtat gtaggccgcg ttgtatccga taaaatggat        60
     aaaaccatta ccgttcttgt tgaaacatac aaaaaacatc cgctttacgg caaacgcgtg       120
     aaatattcaa aaaaatataa agcgcatgac gaaaataaca ttgcgaaagt cggcgatatc       180
     gttaaaatta tggaaactcg tccgctttcg gcaacgaaac gtttccgttt agtcgaaatc       240
     gttgaaaaag cagttatcgt ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page