(data stored in ACNUC7421 zone)

EMBL: CP002293.PE120

CP002293.PE120       Location/Qualifiers
FT   CDS_pept        139736..140104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0120"
FT                   /product="ribosomal protein L14"
FT                   /note="KEGG: gwc:GWCH70_0121 ribosomal protein L14;
FT                   TIGRFAM: ribosomal protein L14; PFAM: ribosomal protein
FT                   L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72976"
FT                   /db_xref="GOA:A0A0F6BHS5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADP72976.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKE
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRSDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
     atgattcaac aagaatctcg tttaaaagtg gctgacaatt caggagcacg cgaagtgctt        60
     gtcattaaag tgttaggtgg ttctggacgc cgctacgcaa acattggcga cgtggttgtt       120
     gcgacagtta aggaagcgac accaggtggc gttgttaaaa aaggtcaagt ggtgaaagca       180
     gtcgttgtcc gtacaaaacg tggcgttcgc cgttctgatg gttcttatat ccgttttgac       240
     gaaaatgctt gcgtcattat tcgtgatgat aaaagcccgc gcggcacacg tatttttgga       300
     ccggttgcac gcgaattgcg cgacaaagat tttatgaaaa tcatttcttt agctccagaa       360
     gtaatttaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page