(data stored in SCRATCH zone)

EMBL: CP002293.PE121

CP002293.PE121       Location/Qualifiers
FT   CDS_pept        140142..140450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0121"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: gwc:GWCH70_0122 ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72977"
FT                   /db_xref="GOA:A0A0F6BHS6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS6"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADP72977.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIITKEAPIHVSKVMPLDPKTGLPTRIGYKIVDGKKVRYAKRSGEILD"
     atgcatgtta aaaaaggtga taaagtccaa gtaatctccg gtaaagacaa aggaaaacaa        60
     ggcgtaatcc ttgctgcgtt tcctaagaaa aaccgtgtaa ttgtcgaagg tgtcaatatc       120
     gttaaaaaac acgcgaaacc atctcaagca aacccgcaag gcggcattat cacaaaagaa       180
     gcaccaattc acgtatcaaa agtaatgcct ttagatccaa aaacggggct tccgactcgc       240
     attggttaca agattgtaga tggtaaaaaa gtgcgttacg caaaaagatc tggtgagatt       300
     ttagattaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page