(data stored in ACNUC7421 zone)

EMBL: CP002293.PE122

CP002293.PE122       Location/Qualifiers
FT   CDS_pept        140481..141020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0122"
FT                   /product="ribosomal protein L5"
FT                   /note="KEGG: gwc:GWCH70_0123 ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72978"
FT                   /db_xref="GOA:A0A0F6BHS7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_0123"
FT                   /protein_id="ADP72978.1"
FT                   /translation="MNRLKEKYLKEVTPALMSKFNYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQKPVVTRAKKSIAGFRLRAGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTAETD
FT                   EEARELLALLGMPFQK"
     atgaaccgcc tgaaagagaa gtacttaaaa gaagtgacac ctgctttaat gagcaagttt        60
     aactataaat ctgtaatgca agtgccaaaa atcgaaaaaa tcgtcatcaa catgggtgtt       120
     ggtgatgcgg tgcaaaatcc aaaagcgctt gacagcgcag tggaagaatt aacattgatc       180
     gctggtcaaa aaccggttgt gactcgtgcg aaaaaatcaa ttgctggttt ccgccttcgt       240
     gctggaatgc caatcggtgc gaaagtaacg ttgcgcggtg agcgcatgta tgagttttta       300
     gataaattga tttctgtatc gcttccacgt gttcgcgatt tccgcggcgt atcgaaaaaa       360
     tcgtttgatg gtcgcggcaa ctatacatta ggcattaaag aacaattaat tttccctgaa       420
     attgattacg ataaagtcaa caaagtccgc ggaatggata tcgtgattgt tactacggcg       480
     gaaacggacg aagaagcccg tgaactattg gcattgctcg gcatgccatt ccaaaaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page