(data stored in ACNUC7421 zone)

EMBL: CP002293.PE124

CP002293.PE124       Location/Qualifiers
FT   CDS_pept        141273..141671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0124"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: gtn:GTNG_0119 SSU
FT                   ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72980"
FT                   /db_xref="GOA:A0A0F6BHS9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHS9"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADP72980.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIA
FT                   ILSTSQGILTDKEARQKGTGGEVLAYVW"
     atggtgatga cagatccaat tgcagatatg ctaactcgca tccgcaatgc gaacatggtg        60
     cgtcatgaga agctagaagt gcctgcttcg aaaattaaac gggaaattgc ggaaatttta       120
     aaacgcgaag gtttcattcg tgatgttgaa tacatcgaag ataataaaca aggcattctc       180
     cgtattttct taaaatacgg cccaaacaat gaacgtgtaa tcactggctt aaaacgcatc       240
     agcaaaccag gcttgcgcgt ttatgtcaaa gcacacgaag tgcctcgtgt attgaacggt       300
     ttaggcattg cgatcctttc tacgtctcaa ggcattttaa ccgataaaga agcgcgtcaa       360
     aaaggaactg gcggcgaagt attagcttat gtttggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page