(data stored in ACNUC7421 zone)

EMBL: CP002293.PE125

CP002293.PE125       Location/Qualifiers
FT   CDS_pept        141703..142239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0125"
FT                   /product="ribosomal protein L6"
FT                   /note="KEGG: gwc:GWCH70_0126 ribosomal protein L6; TIGRFAM:
FT                   ribosomal protein L6; PFAM: Ribosomal protein L6,
FT                   alpha-beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72981"
FT                   /db_xref="GOA:A0A0F6BHT0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT0"
FT                   /inference="protein motif:TFAM:TIGR03654"
FT                   /protein_id="ADP72981.1"
FT                   /translation="MSRVGKKPIEIPSGVTVTVNGNTVTVKGPKGELTRTFHPDMTIKV
FT                   EDNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRAAKQGKKLV
FT                   LNVGFSHPVEIEPEEGLDIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGEVVRLKEGKTGK"
     atgtcacgtg ttggtaaaaa gccaatcgaa attccgtccg gcgtaacggt aacagtgaac        60
     ggcaataccg ttacagtgaa aggaccgaaa ggcgaattaa ctcgtacttt tcatccagat       120
     atgacaatca aagtggaaga taacgttata acagttactc gtccaagcga tgaaaaacat       180
     catcgggcgc ttcatggaac gactcgcagc ttgcttgcta acatggtaga aggcgtatcg       240
     aaaggatacg aaaaagcgct tgaattagtc ggtgtcggtt accgtgcagc gaaacaaggg       300
     aaaaagcttg tgctgaacgt cggtttttct catccagtag aaattgaacc agaagaagga       360
     ttagacattg aagttccttc gcaaacaaaa atcattgtta aaggtgcgga taaacaacgc       420
     gttggcgaac ttgcagcgaa tattcgtgcc gtacgtccac ctgaaccata taaaggaaaa       480
     ggaattcgct acgaaggtga agttgtgcgt cttaaagaag gtaaaactgg taaataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page