(data stored in SCRATCH zone)

EMBL: CP002293.PE126

CP002293.PE126       Location/Qualifiers
FT   CDS_pept        142272..142634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0126"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: gwc:GWCH70_0127 ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72982"
FT                   /db_xref="GOA:A0A0F6BHT1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT1"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADP72982.1"
FT                   /translation="MITKVDRNAVRKRRHARVRKKIFGTAERPRLNVFRSNKHIYAQII
FT                   DDMKAVTLVSASTLDKEFDLASTGNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
     atgatcacaa aagttgaccg aaacgcagtt cgtaaaagaa gacatgcgcg cgttcgcaaa        60
     aaaatattcg gaactgctga acgtccacgc ttaaatgtgt tccgttccaa caaacacatt       120
     tatgcgcaaa ttattgatga tatgaaagca gtaacgcttg tcagcgcttc tacattagat       180
     aaagaatttg acttagcatc gactggaaat atcgaagcag cgaaaaaagt cggtgaacta       240
     gtggcaaaac gagctttaga aaaaggcatt aaaaaagtcg tgttcgaccg cggcggctat       300
     ttatatcatg gtcgtgtaaa ggcgcttgcc gatgctgctc gtgaagctgg tttagaattc       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page