(data stored in ACNUC7421 zone)

EMBL: CP002293.PE128

CP002293.PE128       Location/Qualifiers
FT   CDS_pept        143168..143356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0128"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: ribosomal protein L30; TIGRFAM: ribosomal
FT                   protein L30; PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72984"
FT                   /db_xref="GOA:A0A0F6BHT3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT3"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADP72984.1"
FT                   /translation="MAKKLAITLTRSVIGRPQDQRITVKTLGLRKLHQTVVHHDNPAIR
FT                   GMINKVAHLVKVQEIEE"
     atggcaaaaa aattggcgat taccctcact cgcagcgtca ttggccgtcc gcaagaccaa        60
     cggattacgg tgaaaacgct aggtttgcgc aagttgcacc aaaccgttgt tcatcatgat       120
     aatcctgcta tccgcggcat gattaacaaa gtcgctcacc ttgtgaaagt gcaagaaatc       180
     gaagaataa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page