(data stored in SCRATCH zone)

EMBL: CP002293.PE129

CP002293.PE129       Location/Qualifiers
FT   CDS_pept        143379..143819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0129"
FT                   /product="ribosomal protein L15"
FT                   /note="KEGG: gwc:GWCH70_0130 ribosomal protein L15;
FT                   TIGRFAM: ribosomal protein L15; PFAM: Ribosomal protein
FT                   L18e/L15"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72985"
FT                   /db_xref="GOA:A0A0F6BHT4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT4"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADP72985.1"
FT                   /translation="MKLHELQPAPGSRKERTRVGRGIGSGKGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAIVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSSSAKEAIEAAGGKTEVI"
     atgaaacttc atgaactaca gccagcgcca ggttcccgca aagaacgcac tcgcgttggt        60
     cgcggtatcg gttctggcaa aggcaaaacg tctggcagag gtcaaaaagg tcaaaatgct       120
     cgttctggtg gaggtgtacg cctcggtttt gaaggtggcc aaacgccttt gttccgtcgc       180
     cttccaaaac gcggatttac caacatcaat cgtaaggagt atgcgattgt taaccttgag       240
     aagttaaacc gttttgagga cggaacggaa gtaacacctg aactgctgct tgaaacagga       300
     gttatcagca aactaaaatc gggtgtgaaa attttaggta aaggccaaat tgagaaaaag       360
     ctgacggtaa aagcccataa attctcttct tcggcgaaag aggcaattga agctgctggc       420
     ggtaaaactg aggtgattta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page