(data stored in ACNUC7421 zone)

EMBL: CP002293.PE132

CP002293.PE132       Location/Qualifiers
FT   CDS_pept        145814..146560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0132"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: gwc:GWCH70_0133 methionine aminopeptidase,
FT                   type I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72988"
FT                   /db_xref="GOA:A0A0F6BHT7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT7"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADP72988.1"
FT                   /translation="MIICKTPREIEIMREAGKIVALTRQELEKHIRPGITTKELDQIAE
FT                   AVIRKHGAIPSFKGYNGFPGSICTSVNEELVHGIPGDRVLKEGDIISIDVGAQYNGYHA
FT                   DSAWTYPVGEIAEETKKLLEVTEKSLYIGLEEAKPGARLTNISHAIQTYVESHHFSIVR
FT                   EYVGHGIGQNLHEDPQVPHYGPPNKGPRLKPGMTLCVEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKMCAHFEHTIAITENGYEILTTL"
     atgattattt gcaaaactcc gcgtgaaatt gaaatcatgc gcgaggcagg aaaaatcgtt        60
     gctttaactc gccaagagtt agaaaaacat attcgtccgg gaattacgac aaaagaattg       120
     gatcagatcg ccgaagccgt catccggaaa catggcgcca ttccttcgtt taaaggatat       180
     aacggattcc caggaagcat ctgcacttcg gtgaacgaag agcttgtcca cgggattccc       240
     ggcgaccggg tgttaaagga aggcgatatt attagcattg atgtcggcgc ccaatataac       300
     ggctatcacg ccgactccgc atggacgtat cctgttgggg agattgcgga agaaacgaaa       360
     aaactgcttg aagtaacgga aaaatcttta tatataggat tagaagaagc aaaaccaggt       420
     gcccgtttga ccaatatttc tcatgcgata caaacatatg tggaatccca tcatttttcg       480
     attgttcgtg agtatgtcgg acacggaatt ggtcaaaact tacatgaaga cccgcaagta       540
     ccgcattatg gcccgccaaa taaagggccg cgtttgaaac cgggaatgac gctgtgcgtt       600
     gaaccgatgg tcaatgcggg aagccgttat gtgaaaacac ttgctgataa ctggacagtt       660
     gttacagtag acgggaaaat gtgcgcacat tttgagcata cgatcgctat tacagaaaac       720
     ggctatgaaa ttttaaccac cctctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page