(data stored in ACNUC7421 zone)

EMBL: CP002293.PE133

CP002293.PE133       Location/Qualifiers
FT   CDS_pept        146659..146877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0133"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: afl:Aflv_0128 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72989"
FT                   /db_xref="GOA:A0A0F6BHT8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHT8"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADP72989.1"
FT                   /translation="MAKDDVIEVEGTVVETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
     atggctaaag acgatgtaat tgaagtggaa ggcaccgttg tcgaaacatt gccaaacgct        60
     atgttccgtg tcgaattaga aaacggccat acggtattgg cacatgtttc tggtaaaatt       120
     cgcatgcatt tcattcggat tttacctgga gacaaagtta cggtagaatt atctccgtac       180
     gatttaactc gcggtcgaat cacgtatcgc tataaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page