(data stored in ACNUC7421 zone)

EMBL: CP002293.PE136

CP002293.PE136       Location/Qualifiers
FT   CDS_pept        147440..147829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0136"
FT                   /product="30S ribosomal protein S11"
FT                   /note="KEGG: gwc:GWCH70_0137 ribosomal protein S11;
FT                   TIGRFAM: 30S ribosomal protein S11; PFAM: ribosomal protein
FT                   S11"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72992"
FT                   /db_xref="GOA:A0A0F6BHU1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU1"
FT                   /inference="protein motif:TFAM:TIGR03632"
FT                   /protein_id="ADP72992.1"
FT                   /translation="MARKTNTRKRRVRKNIETGIAHIRSTFNNTIVTITDVHGNTIAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
     atggcacgta aaacaaatac acgcaaacgc cgtgtaagaa aaaatattga gactggtatc        60
     gcgcatatcc gttccacatt caacaatacg atcgtaacga ttaccgacgt tcatggtaac       120
     acgattgctt ggtccagcgc tggagcatta ggttttaaag gctctcgtaa atcgacgcca       180
     tttgcagcac aaatggcagc agaagcggcc gcaaaagcgt ctatggaaca tggaatgaaa       240
     acggtagagg tgaacgtgaa aggccctggt gctggtcgtg aggcagcgat tcgcgcgttg       300
     caagcagctg ggttggaaat aacagcaatt aaagacgtaa ctcctatccc gcataatgga       360
     tgccgtccgc caaaacgtcg tcgtgtgtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page