(data stored in SCRATCH zone)

EMBL: CP002293.PE138

CP002293.PE138       Location/Qualifiers
FT   CDS_pept        149052..149414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0138"
FT                   /product="ribosomal protein L17"
FT                   /note="KEGG: gwc:GWCH70_0139 ribosomal protein L17;
FT                   TIGRFAM: ribosomal protein L17; PFAM: ribosomal protein
FT                   L17"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72994"
FT                   /db_xref="GOA:A0A0F6BHU3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU3"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADP72994.1"
FT                   /translation="MSYRKLGRTSAQRKALLRDLATDLIINERIETTEARAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRKEVANNETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
     atgtcatata gaaaattagg acgtacaagc gctcagcgca aggcattgct tcgtgattta        60
     gcaactgatt taatcattaa tgagcgtatt gaaacaacag aggctcgtgc gaaagaattg       120
     cgttctgttg tcgaaaaaat gattacgctt ggcaaacgcg gtgatttgca tgcacgccgc       180
     caagctgctg catttatccg caaagaagta gccaataacg aaacaggtca agacgcgctg       240
     caaaagctat ttagcgatat tgcaccgcgt tatcaagacc gccaaggcgg ctacactcgc       300
     attatgaaac ttggccctcg tcgcggcgat ggggcaccaa tggtgattat cgaattagtg       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page