(data stored in SCRATCH zone)

EMBL: CP002293.PE14

CP002293.PE14        Location/Qualifiers
FT   CDS_pept        complement(23540..24208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0014"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: gwc:GWCH70_0015
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72870"
FT                   /db_xref="GOA:A0A0F6BHG9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG9"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ADP72870.1"
FT                   /translation="MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSLEKV
FT                   DTNPYLDKFYADFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMH
FT                   FENGTMTAVDYETYTSLFQAMVMTPYFPHPDLLIYLEGSFEEVIKRIRERGRPMEQKTP
FT                   VSYWKEMYERYEKWINEFNACPVLRVNINEYDIIEDEQSIEPIIKKAATIIHEYYHIKK
FT                   "
     atgaacttac gtgaaaaata tcgtattcca gataacgcca tcattacgat tgccggaaca        60
     gttggcgtcg gtaaatcaac catgacaaaa gcattagcaa aagcgttaaa tttccgcact       120
     tccctagaaa aagtcgatac gaatccatat ttagacaagt tttatgctga ttttgaacgg       180
     tggagtttcc atttgcaaat ctattttctt gccgagcggt ttaaagaaca aaaacgaatg       240
     tttgaatatg gcggcggctt tgttcaagat cgttcaattt acgaagacgc gcatattttc       300
     gcaaaaatgc attttgaaaa tggaacaatg acagcagtag attacgaaac atatacgagc       360
     ttatttcaag caatggtaat gacaccatac ttcccgcatc ctgatttgct tatttatttg       420
     gaaggaagtt ttgaagaagt gataaaacgt atccgtgagc gcgggcgccc aatggaacaa       480
     aaaacaccgg tatcatattg gaaagaaatg tatgaacgtt acgaaaaatg gattaatgaa       540
     tttaacgctt gtccggttct tcgcgtaaac attaacgaat atgatattat cgaagacgag       600
     cagtccatcg aaccaatcat taaaaaagcg gcaacgatta ttcatgaata ttatcacata       660
     aaaaaataa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page