(data stored in SCRATCH zone)

EMBL: CP002293.PE140

CP002293.PE140       Location/Qualifiers
FT   CDS_pept        150355..151230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0140"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0141 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72996"
FT                   /db_xref="GOA:A0A0F6BHU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP72996.1"
FT                   /translation="MDIIFEKVEHVYNANSPFARRALYDVDIMIESGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLQPTSGIVKVGNQTITNKKRQRNLKPLRKKVGIVFQFPEHQLFEETVE
FT                   KDICFGPMNFGIPEEEAKKKARELIKLVGLPEDVLAKSPFDLSGGQMRRVAIAGVLAME
FT                   PDVIVLDEPTAGLDPRGRKEIMEMFYRLHQEKRLTTVLVTHSMEDAAAYADYMIVMHKG
FT                   TVWKTGTPQQIFQDSDALAEIGLHVPETVRLKQELEKKLGIAVPSPCLTIEETVDAIQK
FT                   LFSKVSAHDE"
     atggacatta tatttgaaaa ggtagaacat gtatataatg ccaactcacc gtttgcccgc        60
     cgagcgttat atgacgtgga catcatgatt gaaagcggtt cttacgtggc ggttattggg       120
     catactggct caggaaaatc aacgttgctc cagcatttaa acgggctgct ccagccgaca       180
     agcggaatcg tgaaagtagg aaatcaaacg atcacaaaca aaaagcggca acggaactta       240
     aagccgcttc gcaaaaaagt tggcattgtc tttcaatttc cggaacacca actatttgag       300
     gaaacggtgg agaaagatat atgtttcggg ccaatgaatt tcggcatccc cgaagaagaa       360
     gcaaaaaaga aggcaaggga gctgattaag ctagtcgggc ttccggaaga cgtgttagcc       420
     aagtctccgt ttgatttaag cggcgggcaa atgcgccgtg ttgccattgc cggagtgctt       480
     gcgatggaac ctgatgtgat tgtgctggac gagccgacgg ctggcttaga tccgcgcggg       540
     cgcaaagaaa ttatggaaat gttttaccgc cttcatcaag aaaaacggct gacgacggtg       600
     ttagtgaccc atagcatgga agacgctgcc gcgtatgcag attatatgat cgtcatgcat       660
     aaagggaccg tatggaaaac gggaacgccg cagcaaattt tccaagatag cgatgcttta       720
     gcggaaattg gtctccatgt accggagaca gtgcgcctga aacaagaatt ggaaaaaaaa       780
     ttagggattg ccgtgccgtc tccgtgtctg acgatcgaag agactgtaga cgctattcaa       840
     aaattgtttt ccaaggtgag cgcccatgat gaatag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page