(data stored in ACNUC7421 zone)

EMBL: CP002293.PE143

CP002293.PE143       Location/Qualifiers
FT   CDS_pept        152933..153370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0143"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: gwc:GWCH70_0144 ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72999"
FT                   /db_xref="GOA:A0A0F6BHU8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHU8"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADP72999.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAAILRGKHKPTF
FT                   TPHVDCGDHVIIINAEKIELTGKKLTKKLYYRHSLHPGGLKVRTALEMRTNYPEQMLER
FT                   AVRGMLPKGRLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
     atgcgcacaa cttacatggc aaagccgaat gaagtagaac gtaaatggta tgttgtcgac        60
     gctgcaggca aaacgttagg acgccttgca agcgaagtag cagccatttt gcgcggcaaa       120
     cataaaccaa cattcacgcc acatgtggat tgcggcgatc atgtcatcat tatcaatgcg       180
     gaaaaaatcg aactgaccgg aaaaaaactg acaaagaaat tatattaccg tcatagcttg       240
     catccaggcg gattaaaagt gagaacagca ttagaaatgc gcacaaatta tccggaacaa       300
     atgctggaaa gagcggtacg cggaatgctt ccaaaaggtc gcttaggccg ccaaatgttt       360
     aaaaaattgc acgtttaccg cggaagcgaa catccacatc aagcacaaaa gcctgaagtt       420
     tatgaacttc gcggataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page